Align cysteine synthase (EC 2.5.1.47) (characterized)
to candidate WP_012567166.1 RC1_RS09535 pyridoxal-phosphate dependent enzyme
Query= BRENDA::P37887 (308 letters) >NCBI__GCF_000016185.1:WP_012567166.1 Length = 461 Score = 222 bits (565), Expect = 1e-62 Identities = 126/308 (40%), Positives = 183/308 (59%), Gaps = 14/308 (4%) Query: 5 ANSITELIGNTPIVKLNRLADENSADVYLKLEYMNPGSSVKDRIGLAMIEAAEKEGKLKA 64 A +I +IG TP+++++ D ++YLKLE NPG S+KDRIGL MIEAAE EG+LK Sbjct: 10 APAILSMIGGTPVIRVSTF-DTGPCELYLKLENQNPGGSIKDRIGLKMIEAAEAEGRLKP 68 Query: 65 GNTIIEPTSGNTGIGLAMVAAAKGLKAILVMPDTMSMERRNLLRAYGAELVLTPGAEGMK 124 G T+IE T+GNTG+GLA+V AAKG + ILV+PD M++E+ N LRA GAE+ +T G K Sbjct: 69 GGTVIEATAGNTGLGLALVCAAKGYRLILVIPDKMAVEKINHLRALGAEIHITRSDVG-K 127 Query: 125 GAIKKAEELAEKHGYFVP-----QQFNNPSNPEIHRQTTGKEIVEQFGDDQLDAFVAGIG 179 G +++AE+ +P QF NP+NP H + TG E++ Q D +DA V G+G Sbjct: 128 GHPDYYQDIAERLAADIPGSVYMNQFANPANPRAHEEWTGPELLRQM-DGDVDAVVVGVG 186 Query: 180 TGGTITGAGEVLKEAYPSIKIYAVEPSDSPVL------SGGKPGPHKIQGIGAGFVPDIL 233 +GGT+TG G +A P K+ +P+ S + + +PG ++G+G FVP Sbjct: 187 SGGTMTGLGAFFAKASPKTKMVIADPAGSIIADLVNKGTHEEPGSWVVEGVGEDFVPPNC 246 Query: 234 NTEVYDEIFPVKNEEAFEYARRAAREEGILGGISSGAAIYAALQVAKKLGKGKKVLAIIP 293 + + V + E+ AR R EGILGG SSG + AL+ + ++V+ + Sbjct: 247 DLRYAKAAYYVSDAESLTAARDLLRREGILGGSSSGTLLAGALKYCRDQTTRQRVVTFVC 306 Query: 294 SNGERYLS 301 G +YLS Sbjct: 307 DTGNKYLS 314 Lambda K H 0.313 0.134 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 320 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 461 Length adjustment: 30 Effective length of query: 278 Effective length of database: 431 Effective search space: 119818 Effective search space used: 119818 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory