Align cysteine synthase (EC 2.5.1.47) (characterized)
to candidate WP_012568193.1 RC1_RS14565 cysteine synthase A
Query= BRENDA::Q2PZM5 (319 letters) >NCBI__GCF_000016185.1:WP_012568193.1 Length = 333 Score = 490 bits (1261), Expect = e-143 Identities = 250/316 (79%), Positives = 278/316 (87%) Query: 4 SEFRGKIYDSILDTVGATPLVRVNRLAEDAGAKAQIVGKLEFFNPLASVKDRIGFAMIDA 63 +EFRG+IYDSILDTVGATPLVR++RLA G A +V K EFFNPL+SVKDRIG AMI+A Sbjct: 18 AEFRGRIYDSILDTVGATPLVRLSRLAAKHGVVADVVAKCEFFNPLSSVKDRIGKAMIEA 77 Query: 64 AERAGTIEPGRTTLVEPTSGNTGIALAFVAAAKGYRLILTMPESMSVERRKMLKLLGAEL 123 AE G I P RT LVEPTSGNTGIALAFVAAAKGYRLILTMPESMSVERRKMLKLLGAEL Sbjct: 78 AEADGLIAPDRTVLVEPTSGNTGIALAFVAAAKGYRLILTMPESMSVERRKMLKLLGAEL 137 Query: 124 VLTPAAEGMKGAIRRADEIVATDPNAYMLQQFKNAANPEIHRNTTAEEIWKDTDGKADFL 183 VLTPA GMKGAI RA+EIVA+ P+AYMLQQFKN ANP +HR TTAEEIW+DT G+AD L Sbjct: 138 VLTPAPNGMKGAIARAEEIVASTPDAYMLQQFKNPANPAVHRRTTAEEIWRDTAGRADVL 197 Query: 184 ISGVGTGGTLTGVSEVLKARKPGFRTIAVEPEDSPVLSGGMPGPHKIQGIGAGFVPDVLK 243 ++GVGTGGTLTGV+EVLKAR+P FR +AVEPEDSPVLSGG+PGPHKIQGIGAGFVPDVL Sbjct: 198 VAGVGTGGTLTGVAEVLKARRPDFRVVAVEPEDSPVLSGGLPGPHKIQGIGAGFVPDVLA 257 Query: 244 KDLIDEVVRISNQRAFETARKVAKLEGIPVGISSGAALAAALEIGSRPENEGKLIVVILP 303 +D IDEV+RISN RAFE AR A EG+ VGISSGAALAAA E+G+RPE + +LIVVILP Sbjct: 258 RDRIDEVLRISNSRAFELARDAAATEGLAVGISSGAALAAAFEVGARPEMKDRLIVVILP 317 Query: 304 SFAERYLSTALFEGLE 319 SFAERYLSTALF+GL+ Sbjct: 318 SFAERYLSTALFDGLD 333 Lambda K H 0.316 0.135 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 383 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 319 Length of database: 333 Length adjustment: 28 Effective length of query: 291 Effective length of database: 305 Effective search space: 88755 Effective search space used: 88755 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate WP_012568193.1 RC1_RS14565 (cysteine synthase A)
to HMM TIGR01139 (cysK: cysteine synthase A (EC 2.5.1.47))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01139.hmm # target sequence database: /tmp/gapView.21950.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01139 [M=298] Accession: TIGR01139 Description: cysK: cysteine synthase A Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-135 436.3 0.0 3.1e-135 436.1 0.0 1.0 1 lcl|NCBI__GCF_000016185.1:WP_012568193.1 RC1_RS14565 cysteine synthase A Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000016185.1:WP_012568193.1 RC1_RS14565 cysteine synthase A # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 436.1 0.0 3.1e-135 3.1e-135 2 298 .] 29 329 .. 28 329 .. 0.98 Alignments for each domain: == domain 1 score: 436.1 bits; conditional E-value: 3.1e-135 TIGR01139 2 seliGntPlvrLn...laeeakaevlvkleslnPsssvkdrialamiedaekegllkkgk.tiveatsG 66 +++G tPlvrL ++++ a+v++k+e++nP ssvkdri+ amie ae +gl+ +++ ++ve+tsG lcl|NCBI__GCF_000016185.1:WP_012568193.1 29 LDTVGATPLVRLSrlaAKHGVVADVVAKCEFFNPLSSVKDRIGKAMIEAAEADGLIAPDRtVLVEPTSG 97 579*********97444567789***********************************98689****** PP TIGR01139 67 ntGialamvaaargykliltmpetmslerrkllkayGaelvLtdgaegmkgaiekaeelveetpnkyll 135 ntGiala+vaaa+gy+liltmpe+ms+errk+lk +GaelvLt++ +gmkgai++aee+v++tp++y + lcl|NCBI__GCF_000016185.1:WP_012568193.1 98 NTGIALAFVAAAKGYRLILTMPESMSVERRKMLKLLGAELVLTPAPNGMKGAIARAEEIVASTPDAY-M 165 *******************************************************************.* PP TIGR01139 136 lkqfenpanpeihrkttapeilkdldgkldafvagvGtGGtitGvgevlkekkpdikvvavePaespvl 204 l+qf+npanp++hr+tta+ei++d+ g+ d++vagvGtGGt+tGv+evlk +pd++vvaveP++spvl lcl|NCBI__GCF_000016185.1:WP_012568193.1 166 LQQFKNPANPAVHRRTTAEEIWRDTAGRADVLVAGVGTGGTLTGVAEVLKARRPDFRVVAVEPEDSPVL 234 ********************************************************************* PP TIGR01139 205 sggkpgphkiqGigagfiPkvLdkevidevikvsdeeaietarrlakeeGilvGissGaavaaalkvak 273 sgg pgphkiqGigagf+P+vL ++ idev+++s+ a+e+ar a+ eG+ vGissGaa+aaa +v lcl|NCBI__GCF_000016185.1:WP_012568193.1 235 SGGLPGPHKIQGIGAGFVPDVLARDRIDEVLRISNSRAFELARDAAATEGLAVGISSGAALAAAFEVGA 303 ********************************************************************* PP TIGR01139 274 kle.kdkkivvilpdtgerYlstaLf 298 ++e kd++ivvilp+++erYlstaLf lcl|NCBI__GCF_000016185.1:WP_012568193.1 304 RPEmKDRLIVVILPSFAERYLSTALF 329 *999*********************9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (333 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 10.16 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory