Align phosphoribosyl-ATP diphosphatase (EC 3.6.1.31) (characterized)
to candidate WP_012589579.1 MSIL_RS02730 nucleoside triphosphate pyrophosphohydrolase
Query= metacyc::MONOMER-21148 (267 letters) >NCBI__GCF_000021745.1:WP_012589579.1 Length = 290 Score = 161 bits (408), Expect = 1e-44 Identities = 92/273 (33%), Positives = 144/273 (52%), Gaps = 10/273 (3%) Query: 5 NASLARLTDVIDRLLAP-EGCPWDKEQTPESLCDYLVEECFELVEAIRSGNADEVREEMG 63 + + RL +++ L P GC WD QT E++ Y +EE +E+ +AI + ++++E+G Sbjct: 4 STDIQRLLEIMAALRTPGSGCAWDLAQTFETIAPYTIEEAYEVADAIGRRDLPDLKDELG 63 Query: 64 DVMFLLAFLGRLYADKGAFTLDDAMANNAAKMIRRHPHVFSDTTYADRDEFLRNWESIKR 123 D++ +AF R+ + GAF + AKMIRRHPHVF+ +E + W IK Sbjct: 64 DLLLQVAFHARIAEELGAFDFGGVVEAITAKMIRRHPHVFAKQRDLPAEEISKLWSRIKA 123 Query: 124 AEKA---------DAEGEPQGVYDSLPASLPPLLKAYRIHSKAARVGFTWPEDEDVERQV 174 EKA A E + D P +LP L +A ++ +KA+ VGF W + V ++ Sbjct: 124 EEKAAKLAANSEAPAALETESHLDGAPLALPGLTRAVKLQAKASEVGFDWNDARLVLHKI 183 Query: 175 EAEWLELLDVLAGDDKAAQENELGDLIFSLVELGRRKGIKANTALDMTNLKFLRRFRRME 234 E E+ LA + A +E+GDL+F++ L R +A+ TN+KF RRFR +E Sbjct: 184 REETDEIEAALASGEAKAIADEIGDLLFAVANLARHVKADPESAVRRTNMKFARRFRFIE 243 Query: 235 ALARERGLDFPALSLDDKDELWNEAKAAEAAAR 267 R + +L + D LWN+AKA E A + Sbjct: 244 QELERRKIPLGQATLAEMDTLWNDAKALERAPK 276 Lambda K H 0.318 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 183 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 290 Length adjustment: 25 Effective length of query: 242 Effective length of database: 265 Effective search space: 64130 Effective search space used: 64130 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory