Align ATP phosphoribosyltransferase (EC 2.4.2.17) (characterized)
to candidate WP_012589843.1 MSIL_RS04145 ATP phosphoribosyltransferase
Query= reanno::Caulo:CCNA_03626 (320 letters) >NCBI__GCF_000021745.1:WP_012589843.1 Length = 325 Score = 271 bits (694), Expect = 1e-77 Identities = 156/322 (48%), Positives = 205/322 (63%), Gaps = 7/322 (2%) Query: 1 MSTPMIFAIPSKGRLKDQVEAWLADCGFKLEMTGGARGYSAELSGLPGVSVRLLSAGDIA 60 MS P + A+PSKGRL++ A+ A G ++ GAR Y L G+ V + LSA DI Sbjct: 1 MSDPFVLAVPSKGRLQENAAAFFARAGLEIAQGRGARDYRGSLVGVKNVEIAFLSAADIV 60 Query: 61 AGLDSGDLHLGVTGEDLLRERGDDMDSRVMLLRALGFGRADLVVTAPKNWLDVDTMADVD 120 A L SG +HLGVTGEDL+RE D D +V LL LGFG A++VV AP+ W+DV TMAD++ Sbjct: 61 AQLASGQVHLGVTGEDLVRESIADADDKVALLTPLGFGFANVVVAAPRAWIDVKTMADLE 120 Query: 121 EVGHAHLARTGRRLRVATKYVTQTRAFFARHGVADYRIVESSGATEGAPAAGAAELVVDI 180 +V ++ AR G+R+RVATKYV TR FFA+ V+DYRIVESSGATEGAPAAG AEL+VDI Sbjct: 121 DVAASYRARRGQRMRVATKYVNLTRRFFAKMHVSDYRIVESSGATEGAPAAGQAELIVDI 180 Query: 181 TTTGATLAANGLKILSDGVILKSQAQLTASLTAGWNGEQLDALRRLLSVVEAK--GRAGK 238 TTTGATLAAN LKIL DG+IL+SQA L ASL+A W+G + R +LS + A+ R + Sbjct: 181 TTTGATLAANALKILDDGIILRSQANLVASLSADWSGPARENARAILSRIAAEELARTTR 240 Query: 239 LATLVWPAEQDRAAQDAVAAFIARGGSRRANGALLATADLFDAAAALAE----AGVEPVT 294 + V P A +A + F AR +G + + AALA+ G + V Sbjct: 241 EVSTVLPCAPASLATEAQSLFSARLRFCAQDGRMSLNCPA-EKVAALADWLIGRGADHVG 299 Query: 295 VSRPDYVFESRSAVLDRFAEAL 316 V+ DYVF + + + ++ L Sbjct: 300 VTALDYVFSAENPLYEKLIAKL 321 Lambda K H 0.318 0.133 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 245 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 320 Length of database: 325 Length adjustment: 28 Effective length of query: 292 Effective length of database: 297 Effective search space: 86724 Effective search space used: 86724 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate WP_012589843.1 MSIL_RS04145 (ATP phosphoribosyltransferase)
to HMM TIGR00070 (hisG: ATP phosphoribosyltransferase (EC 2.4.2.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00070.hmm # target sequence database: /tmp/gapView.10200.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00070 [M=183] Accession: TIGR00070 Description: hisG: ATP phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-57 179.7 0.4 6.1e-57 178.5 0.3 1.6 2 lcl|NCBI__GCF_000021745.1:WP_012589843.1 MSIL_RS04145 ATP phosphoribosylt Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000021745.1:WP_012589843.1 MSIL_RS04145 ATP phosphoribosyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 178.5 0.3 6.1e-57 6.1e-57 3 183 .] 7 209 .. 5 209 .. 0.93 2 ? -2.0 0.0 0.15 0.15 56 79 .. 291 314 .. 289 320 .. 0.79 Alignments for each domain: == domain 1 score: 178.5 bits; conditional E-value: 6.1e-57 TIGR00070 3 iAlp.KGrleeetlkllekaglklskke.erkliasaed.eevevlllrakdiptyvekgaadlGitGk 68 +A+p KGrl+e++ +++++agl++ + + +r++ s ++ve+ +l+a+di+ ++++g+++lG+tG+ lcl|NCBI__GCF_000021745.1:WP_012589843.1 7 LAVPsKGRLQENAAAFFARAGLEIAQGRgARDYRGSLVGvKNVEIAFLSAADIVAQLASGQVHLGVTGE 75 8*************************9999****97766378*************************** PP TIGR00070 69 DlleEsead....vvelldlgfgkcklvlAvpees.dvesledlke...........gkriATkypnlt 121 Dl++Es ad v+ l+ lgfg +++v+A+p+++ dv++++dl++ ++r+ATky+nlt lcl|NCBI__GCF_000021745.1:WP_012589843.1 76 DLVRESIADaddkVALLTPLGFGFANVVVAAPRAWiDVKTMADLEDvaasyrarrgqRMRVATKYVNLT 144 *****65555567999*************************************997555********** PP TIGR00070 122 reylekkg.vkveivkleGavElapllgladaIvDivetGttLrengLkiiee..ilessarlia 183 r++++k++ +++iv+++Ga+E ap++g a++IvDi++tG+tL++n Lki+++ il+s+a+l+a lcl|NCBI__GCF_000021745.1:WP_012589843.1 145 RRFFAKMHvSDYRIVESSGATEGAPAAGQAELIVDITTTGATLAANALKILDDgiILRSQANLVA 209 ********778****************************************9556********96 PP == domain 2 score: -2.0 bits; conditional E-value: 0.15 TIGR00070 56 vekgaadlGitGkDlleEseadvv 79 + +ga ++G+t D++ e+ ++ lcl|NCBI__GCF_000021745.1:WP_012589843.1 291 IGRGADHVGVTALDYVFSAENPLY 314 5689999*******9988666554 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (183 nodes) Target sequences: 1 (325 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 7.40 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory