Align Ornithine aminotransferase; OAT; EC 2.6.1.13; Ornithine--oxo-acid aminotransferase (uncharacterized)
to candidate WP_012589872.1 MSIL_RS04290 acetylornithine transaminase
Query= curated2:C3P3K3 (396 letters) >NCBI__GCF_000021745.1:WP_012589872.1 Length = 400 Score = 238 bits (606), Expect = 3e-67 Identities = 132/373 (35%), Positives = 202/373 (54%), Gaps = 6/373 (1%) Query: 24 IVISKAEGVWVEDPEGNRYMDLLSAYSAVNQGHRHPKIINALIDQANRVTLTSRAFHSDQ 83 + EG W+ +G RY+D + + G+ HP ++ ALI Q ++ TS F Q Sbjct: 14 LAFDHGEGAWLTATDGERYLDFGGGIAVASLGYSHPHLVEALIAQGRKLWHTSNLFEIPQ 73 Query: 84 LGPWYEKVAKLTNKEMVLPMNTGAEAVETAIKTARRWAYDVKKVEANRAEIIVCEDNFHG 143 ++ + + + V N+GAEAVE AIKTAR+ Y + I+ + FHG Sbjct: 74 AERLAARLCEASFADFVFFTNSGAEAVEGAIKTARK--YQSVSGHPEKFRIVTFKGAFHG 131 Query: 144 RTMGAVSMSSNEEYKRGFGPMLPGIIVIPYGDLEALKAAITPNTAAFILEPIQGEAGINI 203 RT+ ++ N +Y GFGP L G + +GDL+A+KAAI P T A ++EPIQGEAGI + Sbjct: 132 RTLATIAAGGNPKYLDGFGPKLEGFDSVEFGDLDAVKAAIGPQTGAVLVEPIQGEAGIRV 191 Query: 204 PPAGFLKEALEVCKKENVLFVADEIQTGLGRTGKVFACDWDNVTPDMYILGKALGGGVFP 263 F++ +C +L V DE+Q G+GRTGK+FA + VTPD+ + K +GGG FP Sbjct: 192 ASTEFMRGLRALCDAHGLLLVYDEVQCGVGRTGKLFAYELYGVTPDIMAIAKGIGGG-FP 250 Query: 264 ISCAAANRDILGVFEPGSHGSTFGGNPLACAVSIAALEVLEEEKLTERSLQLGEKL---V 320 + A R+ G+HG+T+GGNPLA ++ A L+V+ + +G +L + Sbjct: 251 LGAFLATREAGKGMTVGTHGTTYGGNPLATSIGNAVLDVVLAPGFLDHVATVGARLKQGL 310 Query: 321 GQLKEIDNPMITEVRGKGLFIGIELNEPARPYCEQLKAAGLLCKETHENVIRIAPPLVIS 380 L E + VRG+GL +G+EL P + +A +L +NV R+ PPL+IS Sbjct: 311 LTLIEAYPRSVANVRGEGLMLGLELRAPVADFVAAARAEKILVIPAGDNVARLLPPLIIS 370 Query: 381 EEDLEWAFQKIKA 393 E + +++ A Sbjct: 371 EAEAAEGVKRLGA 383 Lambda K H 0.317 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 387 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 396 Length of database: 400 Length adjustment: 31 Effective length of query: 365 Effective length of database: 369 Effective search space: 134685 Effective search space used: 134685 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory