Align acetylornithine deacetylase (EC 3.5.1.16) (characterized)
to candidate WP_012590053.1 MSIL_RS05240 acetylornithine deacetylase
Query= BRENDA::Q92Y75 (374 letters) >NCBI__GCF_000021745.1:WP_012590053.1 Length = 393 Score = 222 bits (565), Expect = 2e-62 Identities = 133/367 (36%), Positives = 190/367 (51%), Gaps = 10/367 (2%) Query: 3 AAEILGKLVGFRSVVGLPNNDVVSWIRGYLESHGIAVDVLPGPEGDRSNIFATIGPKEAR 62 A +L +LVGF + N +V+ + YL G +P GD++ +F TIGPK Sbjct: 15 AIAMLERLVGFDTESSKSNLALVAAVETYLRECGADYVKIPNAIGDKAALFITIGPKIDG 74 Query: 63 GYIISGHMDVVPAAETGWTSDPFRLRVEADRLYGRGTTDMKGFLAAVLAAVPKLAAMPLR 122 G ++SGH DVVP W+SDPF+LR E RLYGRG DMKGF + LA +P+ L Sbjct: 75 GVVLSGHTDVVPVEGQSWSSDPFQLRREEGRLYGRGACDMKGFDSICLAMIPEFQKAALS 134 Query: 123 RPLHLALSYDEEAGCRGVPHMIARLPELCRQPLGAIIGEPTGMRAIRAHKGKAAARLTVR 182 RP+H+ LSYDEE CRG I R +P ++GEPT M+ AHK R V Sbjct: 135 RPIHILLSYDEETTCRGSLDTIRRFGADLPRPGAILVGEPTLMQVADAHKAIVTYRTIVH 194 Query: 183 GRSGHSSRPDQGLNAIHGVAGVLTQAVAEADRL--VGGPFEHVFEPPYSSLQIGTVKGGQ 240 G HSS+P G NA+ ++T+ + L G P F+PP S++++G + GG Sbjct: 195 GHEAHSSKPYLGANAVETACDLVTELYRFNEELGRRGDPSGR-FDPPASTIEVGVIHGGT 253 Query: 241 AVNIIPDSCEVEFEARAISGVDPAELLAPVRK--TAEALTTLGFEVEWQELSAY-----P 293 A NI+ C ++E R++ LA + AL L + + + P Sbjct: 254 ARNILAKQCAFDWEFRSLPDTPQNLALAHLESYIARVALPNLTRNAKDASIETFAEVEVP 313 Query: 294 ALSLEPDAPLAALLEELTGREALPAVSYGTEAGLFQRAGIDAIICGPGDIGRAHKPDEYI 353 L P + +L +L + +V Y TEAG FQ AG ++CGPG I +AH+PDE++ Sbjct: 314 GLGPAPGSVAESLALKLARSNSTISVPYATEAGQFQAAGAPTVVCGPGSIDQAHQPDEFL 373 Query: 354 LIDELMA 360 I ++ A Sbjct: 374 EIAQVEA 380 Lambda K H 0.319 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 384 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 374 Length of database: 393 Length adjustment: 30 Effective length of query: 344 Effective length of database: 363 Effective search space: 124872 Effective search space used: 124872 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_012590053.1 MSIL_RS05240 (acetylornithine deacetylase)
to HMM TIGR01892 (argE: acetylornithine deacetylase (ArgE) (EC 3.5.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01892.hmm # target sequence database: /tmp/gapView.27969.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01892 [M=365] Accession: TIGR01892 Description: AcOrn-deacetyl: acetylornithine deacetylase (ArgE) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.7e-110 353.5 0.0 7.7e-110 353.3 0.0 1.0 1 lcl|NCBI__GCF_000021745.1:WP_012590053.1 MSIL_RS05240 acetylornithine dea Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000021745.1:WP_012590053.1 MSIL_RS05240 acetylornithine deacetylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 353.3 0.0 7.7e-110 7.7e-110 2 364 .. 18 388 .. 17 389 .. 0.94 Alignments for each domain: == domain 1 score: 353.3 bits; conditional E-value: 7.7e-110 TIGR01892 2 ilakLvafdsvsarsnvdlieyvedyleelgvavevlpvadgaeksnllaviGpkegagglvlsGhtDv 70 +l++Lv+fd+ s +sn++l+ ve yl+e g ++p+a g +k l+ +iGpk +gg+vlsGhtDv lcl|NCBI__GCF_000021745.1:WP_012590053.1 18 MLERLVGFDTESSKSNLALVAAVETYLRECGADYVKIPNAIG-DKAALFITIGPKI-DGGVVLSGHTDV 84 6899*****************************9999*9999.************9.9*********** PP TIGR01892 71 vPvdeaaWtsDpfrLtekdgrLYgrGtaDmkGFlalvLaavpdlaaakLkkPlhlvlsaDeevglaGak 139 vPv++++W+sDpf+L+ ++grLYgrG++DmkGF + La +p+ ++a L +P+h++ls+Dee++++G lcl|NCBI__GCF_000021745.1:WP_012590053.1 85 VPVEGQSWSSDPFQLRREEGRLYGRGACDMKGFDSICLAMIPEFQKAALSRPIHILLSYDEETTCRGSL 153 ********************************************************************* PP TIGR01892 140 klieala...rrpalaivGePtslvavRahkGkasakvtvrGreghssrpdrGvsaielaakllarlva 205 + i + +rp ++vGePt ++ ahk +++ + v+G+e+hss+p G++a+e+a +l+++l + lcl|NCBI__GCF_000021745.1:WP_012590053.1 154 DTIRRFGadlPRPGAILVGEPTLMQVADAHKAIVTYRTIVHGHEAHSSKPYLGANAVETACDLVTELYR 222 ***9986688*********************************************************** PP TIGR01892 206 ladklkr.edleeaFtppyatlniGtvkGGkavniiaaaCelvlelRpipGmdpeellallekiaeevk 273 +++l r +d+ F+pp +t+++G+++GG+a ni+a++C + e+R++p + + la+le+ + v lcl|NCBI__GCF_000021745.1:WP_012590053.1 223 FNEELGRrGDPSGRFDPPASTIEVGVIHGGTARNILAKQCAFDWEFRSLPDTPQNLALAHLESYIARVA 291 *****98799*****************************************999999999999888865 PP TIGR01892 274 ekapgfevk.....veelsatpaleleedaelvalleklaGa.aaevvsygteagllqelGieavvlGP 336 ++ +++k + p+l + + ++++ l+ kla + ++ v+y+teag++q +G+++vv+GP lcl|NCBI__GCF_000021745.1:WP_012590053.1 292 LPNLTRNAKdasieTFAEVEVPGLGPAPGSVAESLALKLARSnSTISVPYATEAGQFQAAGAPTVVCGP 360 55555554400000445566899999************998768999********************** PP TIGR01892 337 GdidqahqpdeYveieelkrcrallerl 364 G+idqahqpde++ei +++++ ++++rl lcl|NCBI__GCF_000021745.1:WP_012590053.1 361 GSIDQAHQPDEFLEIAQVEAGIEFMRRL 388 *************************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (365 nodes) Target sequences: 1 (393 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 12.00 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory