Align Homoserine O-acetyltransferase; HAT; Homoserine transacetylase; HTA; EC 2.3.1.31 (characterized)
to candidate WP_012590062.1 MSIL_RS21000 homoserine O-acetyltransferase
Query= SwissProt::Q9AAS1 (382 letters) >NCBI__GCF_000021745.1:WP_012590062.1 Length = 394 Score = 515 bits (1326), Expect = e-151 Identities = 246/366 (67%), Positives = 298/366 (81%), Gaps = 2/366 (0%) Query: 17 FPANEPLRLDSGGVIEGLEIAYQTYGQLNADKSNAVLICHALTGDQHVASPHPTTGKPGW 76 F + L++DSGG + IAYQTYG+LNA KSNA+L+CHALTGDQHVA+ HP TGKPGW Sbjct: 25 FGPDHALQMDSGGRLNQWTIAYQTYGELNAAKSNAILVCHALTGDQHVANAHPVTGKPGW 84 Query: 77 WQRLVGPGKPLDPARHFIICSNVIGGCMGSTGPASINPATGKTYGLSFPVITIADMVRAQ 136 W +VGPG+P+D R+F+ICSNVIGGCMG+TGPAS+NP TG+ YGL P++TI DMVRAQ Sbjct: 85 WSTMVGPGRPIDTDRYFVICSNVIGGCMGTTGPASLNPQTGRPYGLELPIVTIRDMVRAQ 144 Query: 137 AMLVSALGVETLFAVVGGSMGGMQVQQWAVDYPERMFSAVVLASASRHSAQNIAFHEVGR 196 AML+ LGV+TLF VVGGSMGGMQV QW +PER+FSA+ +A+A++HS+QNIAFHEVGR Sbjct: 145 AMLIDHLGVDTLFCVVGGSMGGMQVLQWVASFPERVFSAMPIATAAKHSSQNIAFHEVGR 204 Query: 197 QAIMADPDWRGGAYAEHGVRPEKGLAVARMAAHITYLSEPALQRKFGRELQ-RDGLSWGF 255 QA+MADPDWR G Y E GV P KGLAVARMAAHITYLS+ ALQ KFGR+LQ RD ++ F Sbjct: 205 QAVMADPDWRKGRYLEEGVIPTKGLAVARMAAHITYLSDEALQSKFGRKLQDRDAPTFSF 264 Query: 256 DADFQVESYLRHQGSSFVDRFDANSYLYITRAMDYFDIAASHGGVLAKAFTRARNVRFCV 315 DA+FQ+E+YLR+QGSSFVDRFD NSYLY+TRA DYFD+AA + G LA+AF + RFCV Sbjct: 265 DAEFQIENYLRYQGSSFVDRFDPNSYLYVTRACDYFDLAADYDGSLARAFQGVK-ARFCV 323 Query: 316 LSFSSDWLYPTAENRHLVRALTAAGARAAFAEIESDKGHDAFLLDEPVMDAALEGFLASA 375 +SF+SDWLYPTA +R +V AL A GA +F +IE+D+GHDAFLLD P A +GFL SA Sbjct: 324 VSFNSDWLYPTAASRAIVHALNAGGASVSFVDIETDRGHDAFLLDLPEFIATSQGFLDSA 383 Query: 376 ERDRGL 381 + RGL Sbjct: 384 AKARGL 389 Lambda K H 0.321 0.135 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 496 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 394 Length adjustment: 30 Effective length of query: 352 Effective length of database: 364 Effective search space: 128128 Effective search space used: 128128 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
Align candidate WP_012590062.1 MSIL_RS21000 (homoserine O-acetyltransferase)
to HMM TIGR01392 (metX: homoserine O-acetyltransferase (EC 2.3.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01392.hmm # target sequence database: /tmp/gapView.8712.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01392 [M=351] Accession: TIGR01392 Description: homoserO_Ac_trn: homoserine O-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-146 472.8 0.0 4.1e-146 472.5 0.0 1.1 1 lcl|NCBI__GCF_000021745.1:WP_012590062.1 MSIL_RS21000 homoserine O-acetyl Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000021745.1:WP_012590062.1 MSIL_RS21000 homoserine O-acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 472.5 0.0 4.1e-146 4.1e-146 3 347 .. 29 377 .. 27 381 .. 0.97 Alignments for each domain: == domain 1 score: 472.5 bits; conditional E-value: 4.1e-146 TIGR01392 3 eeltlesGevlsevevayktyGtlnaerdNavlvcHaltgsahvagkadeedk.GWWdellGpgraldt 70 + l+++sG+ l++ ++ay+tyG+lna+++Na+lvcHaltg++hva+ + + k GWW++++Gpgr++dt lcl|NCBI__GCF_000021745.1:WP_012590062.1 29 HALQMDSGGRLNQWTIAYQTYGELNAAKSNAILVCHALTGDQHVANAHPVTGKpGWWSTMVGPGRPIDT 97 5799*****************************************999877667*************** PP TIGR01392 71 sryfvvclNvlGsckGstgPlsinpetgkpygaefPlvtirDlvkaqkalldsLgveklaavvGgSlGG 139 +ryfv+c+Nv+G+c G+tgP+s+np+tg+pyg e+P vtirD+v+aq++l+d+Lgv++l++vvGgS+GG lcl|NCBI__GCF_000021745.1:WP_012590062.1 98 DRYFVICSNVIGGCMGTTGPASLNPQTGRPYGLELPIVTIRDMVRAQAMLIDHLGVDTLFCVVGGSMGG 166 ********************************************************************* PP TIGR01392 140 mqalewalsypervkkivvlatsarasaqaiafnevqrqailsDpeyndGeyaeee.qPekGLalARml 207 mq+l+w++s perv +++++at+a++s+q+iaf+ev rqa+++Dp++++G+y ee+ P+kGLa+ARm lcl|NCBI__GCF_000021745.1:WP_012590062.1 167 MQVLQWVASFPERVFSAMPIATAAKHSSQNIAFHEVGRQAVMADPDWRKGRYLEEGvIPTKGLAVARMA 235 ********************************************************9************ PP TIGR01392 208 alltYrseesleerfgreakseeslassleeefsvesylryqgkkfverFdAnsYllltkaldthdlar 276 a++tY+s+e+l+++fgr+ ++++++++s+++ef++e ylryqg++fv+rFd nsYl++t+a d++dla+ lcl|NCBI__GCF_000021745.1:WP_012590062.1 236 AHITYLSDEALQSKFGRKLQDRDAPTFSFDAEFQIENYLRYQGSSFVDRFDPNSYLYVTRACDYFDLAA 304 ********************************************************************* PP TIGR01392 277 grrdslkealkkikapvlvvgiesDllftleeqeelakalkaakle..yaeieseeGHDaFllekekve 343 ++++sl++a++ +ka+++vv+++sD+l++++ ++ +++al+a +++ ++ ie+++GHDaFll+ ++ lcl|NCBI__GCF_000021745.1:WP_012590062.1 305 DYDGSLARAFQGVKARFCVVSFNSDWLYPTAASRAIVHALNAGGASvsFVDIETDRGHDAFLLDLPEFI 373 *****************************************9998888****************98877 PP TIGR01392 344 elir 347 ++ + lcl|NCBI__GCF_000021745.1:WP_012590062.1 374 ATSQ 377 6655 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (394 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 12.06 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory