Align phosphoserine transaminase (EC 2.6.1.52) (characterized)
to candidate WP_012590731.1 MSIL_RS08730 aminotransferase class V-fold PLP-dependent enzyme
Query= BRENDA::P74281 (384 letters) >NCBI__GCF_000021745.1:WP_012590731.1 Length = 396 Score = 264 bits (675), Expect = 3e-75 Identities = 152/381 (39%), Positives = 223/381 (58%), Gaps = 5/381 (1%) Query: 1 MDNKQMLMIPGPTPVPEKVLLAMAKHPIGHRSGDFSKIIAELTANLKWLHQTEN-DVLML 59 M + L +PGPT VPE+V AM HRS F ++ L +LK +++T++ V + Sbjct: 1 MPGRHFLFVPGPTNVPERVARAMVVPMEDHRSPKFPELTLPLFQDLKKIYKTKDGQVFLF 60 Query: 60 TTSGTGAMEASIINFLSPGDRVLVGNNGKFGDRWVKVAKTFGLAVEEIKAEWGKALDPND 119 +SGTGA E++ N LSPGD+VL+ G+F W+ +A+ G V+ ++ EWG + P Sbjct: 61 PSSGTGAWESAFNNTLSPGDKVLMSRFGQFSHLWIDMAQRMGFDVQILEEEWGTGVKPEK 120 Query: 120 FKTLLEADSDKTIKALIITHSETSTGVLNDLAAINAAAKAHGG-ALMIVDAVTSLGATPV 178 + +L AD IKA+ TH+ET+TGV +D+AA+ A A G AL+ VDAV+SLG+ Sbjct: 121 IEEILRADKSHQIKAVTATHNETATGVASDIAAVRKAMDAAGHPALLFVDAVSSLGSLDF 180 Query: 179 AIDDLGLDVVASGSQKGYMIPPGLGFVSVSAKAWQAYETATIPRFYLDLKKYKKSTDEDS 238 D+ G+D+ SGSQKG M+P GLG + VS KA A +TAT R Y D K+ Sbjct: 181 RQDEWGVDLAVSGSQKGLMLPAGLGVLGVSQKALAASKTATSKRCYFDFDDMIKANATGY 240 Query: 239 SPFTPPINLMYGLQASLQMMKAEGLDAIFTRHQRHTNATRGAMKALNL-PLFAPDNAASN 297 P+TPP+ L+YGL+ SL+M++ EGL+ IF RH R A+KA L P S+ Sbjct: 241 FPYTPPLPLLYGLRESLKMIEDEGLENIFVRHSHLAGGVRAAVKAWGLTPCAKEPKWYSD 300 Query: 298 AITA-VAPLGVEAEKIRSTMRKKFDIAMAGGQDHLKGKIFRIGHLGFVCDRDILSCIGAL 356 +TA V P A ++ ST ++++++ G + GK+FRIGHLG + + +L + Sbjct: 301 TVTAIVVPPQFNAVQVISTAYSRYNLSLGAGLSQVAGKVFRIGHLGDLNELMVLGALAGA 360 Query: 357 EATLIELGYEGVTPGSGVAAA 377 E + ++G VT GSGV AA Sbjct: 361 EMAMADVGIP-VTLGSGVGAA 380 Lambda K H 0.317 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 376 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 396 Length adjustment: 31 Effective length of query: 353 Effective length of database: 365 Effective search space: 128845 Effective search space used: 128845 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory