Align Alpha-aminoadipate--LysW ligase LysX; AAA--LysW ligase LysX; EC 6.3.2.43 (characterized)
to candidate WP_012591387.1 MSIL_RS12200 lysine biosynthesis protein LysX
Query= SwissProt::Q5SH23 (280 letters) >NCBI__GCF_000021745.1:WP_012591387.1 Length = 321 Score = 87.8 bits (216), Expect = 3e-22 Identities = 65/198 (32%), Positives = 98/198 (49%), Gaps = 20/198 (10%) Query: 63 LAAARYLTALGIPVVNRPEVIEACGDKWATSVALAKAGLPQPKT--ALATDREEALRLME 120 L+ L LG+PV N +E C DK ATS ALA A +P P T A +TD + E Sbjct: 90 LSVLHALRDLGVPVANPARAVEICVDKAATSFALAHAKIPTPPTWAAQSTDAARKILRRE 149 Query: 121 AFGYPVVLKPVIGSWG---RLLAKVTDRAAAEALLEHKEVLGGFQHQLFYIQEYV---EK 174 P+VLKP+ G+ G RL+ D EA+ ++Y+Q ++ + Sbjct: 150 ISRGPLVLKPLFGAQGFGLRLIQSEDDLPPIEAV-----------EYVYYLQRFIGPRKD 198 Query: 175 PGRDIRVFVVGERAIAAIYRRSAHWITNTARGGQAENCPLTEEVARLSVKAAEAVGGGVV 234 D+R FV + I A+ RR+A+WITN G + E + + L+++A+ AVG Sbjct: 199 VYSDMRFFVSDGKVIGAMIRRAANWITNIKLGARPEWLEPDDALTALALRASSAVGAQFA 258 Query: 235 AVD-LFESERGLLVNEVN 251 VD + +++ V EVN Sbjct: 259 GVDIILDADGAPQVLEVN 276 Lambda K H 0.319 0.136 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 196 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 280 Length of database: 321 Length adjustment: 27 Effective length of query: 253 Effective length of database: 294 Effective search space: 74382 Effective search space used: 74382 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory