Align asparagine-oxo-acid transaminase (EC 2.6.1.14); alanine-glyoxylate transaminase (EC 2.6.1.44); serine-glyoxylate transaminase (EC 2.6.1.45) (characterized)
to candidate WP_012592368.1 MSIL_RS17280 aminotransferase class V-fold PLP-dependent enzyme
Query= BRENDA::Q56YA5 (401 letters) >NCBI__GCF_000021745.1:WP_012592368.1 Length = 402 Score = 355 bits (911), Expect = e-102 Identities = 183/384 (47%), Positives = 250/384 (65%), Gaps = 3/384 (0%) Query: 8 GRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSGTPFLFPT 67 G+H L +PGP +PE V+RAMN+ D+R P L + +L K +FKT SG ++P+ Sbjct: 6 GQHFLQIPGPSPVPERVLRAMNKQVIDHRGPEFQLLGEEVLAGCKSVFKT-SGPVVIYPS 64 Query: 68 TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQGANLQVLA 127 +GTGAWE+A+ NTLSPGD+++ G FS LW + + D + DW +GA+ + Sbjct: 65 SGTGAWEAAIVNTLSPGDKVLMAETGHFSTLWRQMAAKWGLDADFMPGDWRRGADPVAIE 124 Query: 128 SKLSQDENHTIKAICIVHNETATGVTNDISAVRTLLDHYKHPALLLVDGVSSICALDFRM 187 +KL++D +H IKA+ +VHNET+TGVT+ I +RT +D HPALLLVD +SS+ ++D+R Sbjct: 125 AKLAEDRSHAIKAVMVVHNETSTGVTSRIGEIRTAIDRTGHPALLLVDTISSLGSVDYRH 184 Query: 188 DEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYKLGTYW 247 DEWGVDV ++ SQK L LP GLG S KAL A+KT+K + ++DW + LK G ++ Sbjct: 185 DEWGVDVTISCSQKGLMLPPGLGFTAISDKALAASKTNKFPRSYWDWQEMLKPNAAG-FF 243 Query: 248 PYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNCTQKEEWISNT 307 PYTP+ LLYGLR A+ ++ EEGL+ + RH RL ATR AV AWGL+ ++ S Sbjct: 244 PYTPATTLLYGLREAIAMLLEEGLDQVFERHHRLAAATRAAVRAWGLEVLCEEPSEYSPV 303 Query: 308 VTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLAGVE 367 +TAV+ PP D ++YN+SLG GLNK+AGKVFRIGHLG NEL L+ L+GVE Sbjct: 304 LTAVLTPPGHDADHFRNVVLEKYNMSLGTGLNKLAGKVFRIGHLGQCNELVLMAALSGVE 363 Query: 368 MILKDVGYPVVMGSGVAAASTYLQ 391 M L G P G GV AA L+ Sbjct: 364 MGLSAAGIPHRAG-GVMAAMAELE 386 Lambda K H 0.320 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 466 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 402 Length adjustment: 31 Effective length of query: 370 Effective length of database: 371 Effective search space: 137270 Effective search space used: 137270 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory