Align [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase; EC 2.6.1.118; EC 2.6.1.124 (uncharacterized)
to candidate WP_012673760.1 SULAZ_RS04620 glutamate-1-semialdehyde 2,1-aminomutase
Query= curated2:Q7SI94 (388 letters) >NCBI__GCF_000021545.1:WP_012673760.1 Length = 427 Score = 144 bits (362), Expect = 6e-39 Identities = 109/329 (33%), Positives = 160/329 (48%), Gaps = 20/329 (6%) Query: 13 IKIIKGEGQYVWDEKNNKYLDMHAGHGVAFLGHRNKVIIDHLKKQMEEISTLSLAFDTPI 72 I I +G+G +WD N+Y+D G LGH + +++ +K Q+ T S T + Sbjct: 36 IFIQRGKGSRIWDVDGNEYIDYVLSWGPLILGHAHDQVVNAIK-QVANYGT-SFGAPTEL 93 Query: 73 REEMIKEL-DELKPEDLDNLFLLNSGSEAVELALKIARKITKRRKIVAFKNSFHGR---- 127 EM K + D +K ++ + +NSG+EA A+++AR TKR+KIV F +HG Sbjct: 94 EIEMAKAVVDAVKSVEM--VRFVNSGTEATMSAIRLARGYTKRKKIVKFDGCYHGHGDSL 151 Query: 128 --SMGALSVTWNKKYREPF-EPLIGPVEFLEYNNVDSL----KSITEDTAAVIVEPVQGE 180 S G+ T E L L YN+++++ K ED A VI+EPV G Sbjct: 152 LVSAGSGVATLGIPGTPGIPEELANLTIVLPYNDIEAVEEAFKRYGEDIACVIIEPVAGN 211 Query: 181 GGVIPAKKEFVKSLREVTEKVNALLIIDEVQTGFGRTGKIWAYQHFDIKPDILTAGKAIG 240 GV+ KE+ + LR++T K ALLI DEV TGF R A + + I PD+ T GK IG Sbjct: 212 MGVVAPSKEYHQRLRDITRKYGALLIFDEVMTGF-RLAYGGAQELYGIDPDLTTFGKVIG 270 Query: 241 GGFPVSAVFLPNWISEKIEEGD---HGSTYGGNPLAAAAVTAACKVAKSEKIAEQAQKKG 297 GG PV A I E + T GNPLA AA ++ K + +KG Sbjct: 271 GGLPVGAYGGKREIMEYVAPVGPVYQAGTLSGNPLAMAAGLRQLQLLKELNPYRELDEKG 330 Query: 298 ELFMRILKEKLEDFKIVREIRGLGLMIGI 326 K+ ++F ++ +G MI + Sbjct: 331 RFLEEGFKQIAQEFSAAIQVNRVGSMITV 359 Lambda K H 0.317 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 398 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 427 Length adjustment: 31 Effective length of query: 357 Effective length of database: 396 Effective search space: 141372 Effective search space used: 141372 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory