Align phosphoribosylanthranilate isomerase (EC 5.3.1.24) (characterized)
to candidate WP_012674528.1 SULAZ_RS04635 indole-3-glycerol phosphate synthase TrpC
Query= BRENDA::P00909 (453 letters) >NCBI__GCF_000021545.1:WP_012674528.1 Length = 260 Score = 159 bits (403), Expect = 7e-44 Identities = 105/254 (41%), Positives = 147/254 (57%), Gaps = 8/254 (3%) Query: 5 VLAKIVADKAIWVEAR--KQQQPLASFQNEVQPSTRHFYDALQGARTAFILECKKASPSK 62 +L KI+ K +E K + L S E + F AL+G I E KKASPSK Sbjct: 3 ILEKIIQTKKQELENYNDKYVKHLESLSLERKKKVLDFKKALKGKDINIIAEVKKASPSK 62 Query: 63 GVIRDDFDPARIAAIYKHY-ASAISVLTDEKYFQGSFNFLPIVSQIAPQPILCKDFIIDP 121 GVIR DFDP IA IY+ A AISVLTD++YFQGS +L +S+ P+L KDFIID Sbjct: 63 GVIRHDFDPLTIAKIYEENGAKAISVLTDKQYFQGSIEYLYNISKEVKLPLLRKDFIIDK 122 Query: 122 YQIYLARYYQADACLLMLSVLDDDQYRQLAAVAHSLEMGVLTEVSNEEEQERAIALGAKV 181 QI A Y AD+ LL+ VL + ++ L M L E+ + +E +++ GA + Sbjct: 123 RQILEAYAYGADSYLLIAKVLTLQEIKEFINFGKELGMEPLVEIHSYDEGVKSLYAGAVI 182 Query: 182 VGINNRDLRDLSIDLNRTRELAPK---LGHNVTVISESGINTYAQVRELSHF-ANGFLIG 237 +GINNR L +D+N +++LAPK LG V V++ESG+NT ++ EL ++ + FLIG Sbjct: 183 IGINNRSLETFEVDINLSKQLAPKMKELGAEV-VVAESGLNTKQELLELKNYQVDAFLIG 241 Query: 238 SALMAHDDLHAAVR 251 +LM D+ +R Sbjct: 242 ESLMRERDIGKKLR 255 Lambda K H 0.320 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 256 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 453 Length of database: 260 Length adjustment: 29 Effective length of query: 424 Effective length of database: 231 Effective search space: 97944 Effective search space used: 97944 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory