Align Histidine biosynthesis trifunctional protein; EC 3.5.4.19; EC 3.6.1.31; EC 1.1.1.23 (characterized)
to candidate WP_012674840.1 SULAZ_RS04990 histidinol dehydrogenase
Query= SwissProt::P00815 (799 letters) >NCBI__GCF_000021545.1:WP_012674840.1 Length = 428 Score = 266 bits (679), Expect = 2e-75 Identities = 167/424 (39%), Positives = 246/424 (58%), Gaps = 22/424 (5%) Query: 370 VQKALSRPIQKTSEIMHLVNPIIENVRDKGNSALLEYTEKFDGVKLSNPVLNAPFPE--E 427 VQ + R +T V II+NV+++G+ AL+EYTEKFD +K++ L PF E + Sbjct: 17 VQYLIKRSDVETDLYEAAVKEIIKNVKERGDEALVEYTEKFDKIKINPEDLIIPFEELEK 76 Query: 428 YFEGLTEEMKEALDLSIENVRKFHAAQLPTETLEVETQPGVLCSRFPRPIEKVGLYIPGG 487 ++ + EE++ A +++ E + +FH +L E + + G++ + P+EKVGLY+PGG Sbjct: 77 AYDEIEEEVRWAFEVAYERLYEFH--ELQKEKSFFKEEDGIILGQKVVPLEKVGLYVPGG 134 Query: 488 TAILPSTALMLGVPAQVAQCKEIVFASPPRKSDGKVSPEVVYVAEKVGASKIVLAGGAQA 547 A PS+ LM VPA+VA +EIV SP + K + ++ G + GGAQA Sbjct: 135 KAAYPSSVLMNAVPARVAGVEEIVMCSP---NPNKYTLAAAFIC---GIDTVYRVGGAQA 188 Query: 548 VAAMAYGTETIPKVDKILGPGNQFVTAAKMYVQNDTQALCSIDMPAGPSEVLVIADEDAD 607 VAAMAYGTET+ KVDKI+GPGN +V AK V + IDM AGPSE+LVIADE A+ Sbjct: 189 VAAMAYGTETVKKVDKIVGPGNIYVALAKKNVFG----VVDIDMIAGPSEILVIADETAN 244 Query: 608 VDFVASDLLSQAEHGIDSQVILVGVNLSEKKIQEIQDAVHNQALQ-LPRVDIVRKCI--- 663 +VA+DLLSQAEH D + + SE + +++ ++N+ L+ R +I K + Sbjct: 245 YKWVAADLLSQAEH--DELAASILITTSEDLAKNVKNYLYNEILKDFSRKEIAEKSLNNY 302 Query: 664 AHSTIVLCDGYEEALEMSNQYAPEHLILQIANANDYVKLVDNAGSVFVGAYTPESCGDYS 723 H+ IV + E A E++N APEHL + N D + + +AG++F+G Y+ E GDY Sbjct: 303 GHAFIV--EDLETACELANYLAPEHLEVVTNNPFDLINKIKHAGAIFLGHYSTEPLGDYI 360 Query: 724 SGTNHTLPTYGYARQYSGANTATFQKFITAQNITPEGLENIGRAVMCVAKKEGLDGHRNA 783 G NH LPT AR S F K + ++ EG E + + +AK EGL+ H + Sbjct: 361 LGPNHVLPTSRSARFSSPLGVYDFVKRSSVIYVSKEGFERVANHAINMAKSEGLEAHALS 420 Query: 784 VKIR 787 VK+R Sbjct: 421 VKVR 424 Lambda K H 0.315 0.133 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 794 Number of extensions: 40 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 799 Length of database: 428 Length adjustment: 36 Effective length of query: 763 Effective length of database: 392 Effective search space: 299096 Effective search space used: 299096 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory