Align Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 (characterized)
to candidate WP_012674923.1 SULAZ_RS02340 prephenate dehydratase
Query= SwissProt::P27603 (365 letters) >NCBI__GCF_000021545.1:WP_012674923.1 Length = 360 Score = 307 bits (786), Expect = 3e-88 Identities = 157/363 (43%), Positives = 233/363 (64%), Gaps = 6/363 (1%) Query: 1 MSEADQLKALRVRIDSLDERILDLISERARCAQEVARVKTASWPKAEEAVFYRPEREAWV 60 M ++LK LR ID +D+ IL L+++RA A++V +K K + P RE + Sbjct: 1 MEYQEELKNLRKEIDDIDQTILQLLNKRALLAKQVGEIK-----KKNNLPIFVPSREKEI 55 Query: 61 LKHIMELNKGPLDNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHSVI 120 + + +LN GPL N+ + +FREI+S+C ++E+ ++VAYLGP+ TF+ A+LK+FG +V Sbjct: 56 FERLEKLNTGPLSNDVIKHIFREIISACRSVEENIKVAYLGPKATFTHQASLKYFGSAVD 115 Query: 121 SKPMAAIDEVFREVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHL 180 P++ I +VF E+ VN+GVVPVEN+ EG VN+TLD FL++D+ I GEV L I HL Sbjct: 116 HIPVSTIKDVFEEIAKKKVNYGVVPVENTIEGVVNYTLDMFLDYDLKIIGEVILEISLHL 175 Query: 181 LVGETTKTDRITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIA 240 + + I RIYSH ++A+CR WL + PN + + V S A AA+ + ++ +AAIA Sbjct: 176 M-SINPNINEIQRIYSHKFAIAECRDWLQKNMPNAQIIEVESTAKAAEMARDDYEAAAIA 234 Query: 241 GDMAAQLYGLSKLAEKIEDRPVNSTRFLIIGSQEVPPTGDDKTSIIVSMRNKPGALHELL 300 + AA +YGL L KI+ N TRFLIIG++ PTG DKT+ I S++N+ GAL++ L Sbjct: 235 SESAAIVYGLHILERKIDKHLYNYTRFLIIGNEIPQPTGKDKTTFIFSVKNEVGALYKAL 294 Query: 301 MPFHSNGIDLTRIETRPSRSGKWTYVFFIDCMGHHQDPLIKNVLEKIGHEAVALKVLGSY 360 PF+ N I++T+IE+RPS+ W Y+FF D GH + + LE++ K+LGSY Sbjct: 295 EPFYKNQINMTKIESRPSKKEAWDYIFFTDIEGHIHEEKVSKTLEELKSSVPFFKILGSY 354 Query: 361 PKA 363 PKA Sbjct: 355 PKA 357 Lambda K H 0.319 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 308 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 360 Length adjustment: 29 Effective length of query: 336 Effective length of database: 331 Effective search space: 111216 Effective search space used: 111216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_012674923.1 SULAZ_RS02340 (prephenate dehydratase)
to HMM PF01817 (CM_2)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/PF01817.25.hmm # target sequence database: /tmp/gapView.23435.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: CM_2 [M=79] Accession: PF01817.25 Description: Chorismate mutase type II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-30 90.0 1.3 2.2e-29 88.0 0.8 2.1 2 lcl|NCBI__GCF_000021545.1:WP_012674923.1 SULAZ_RS02340 prephenate dehydra Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000021545.1:WP_012674923.1 SULAZ_RS02340 prephenate dehydratase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 88.0 0.8 2.2e-29 2.2e-29 1 78 [. 11 87 .. 11 88 .. 0.97 2 ? -1.0 0.0 0.13 0.13 57 74 .. 116 133 .. 107 136 .. 0.79 Alignments for each domain: == domain 1 score: 88.0 bits; conditional E-value: 2.2e-29 CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlre...gaeelgldpeavekifr 68 RkeId+iD+ +l+Ll++R+ lak+++e+Kk+n+lp++ p+Re+e++erl++ g+ l+++++++ifr lcl|NCBI__GCF_000021545.1:WP_012674923.1 11 RKEIDDIDQTILQLLNKRALLAKQVGEIKKKNNLPIFVPSREKEIFERLEKlntGP----LSNDVIKHIFR 77 9**************************************************87777....*********** PP CM_2 69 eiisesralQ 78 eiis++r+++ lcl|NCBI__GCF_000021545.1:WP_012674923.1 78 EIISACRSVE 87 *******998 PP == domain 2 score: -1.0 bits; conditional E-value: 0.13 CM_2 57 gldpeavekifreiises 74 +++ ++++++f+ei + lcl|NCBI__GCF_000021545.1:WP_012674923.1 116 HIPVSTIKDVFEEIAKKK 133 5778899999*9998765 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (79 nodes) Target sequences: 1 (360 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 8.72 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory