Align succinyldiaminopimelate transaminase (EC 2.6.1.17); glutamate-prephenate aminotransferase (EC 2.6.1.79) (characterized)
to candidate WP_012675382.1 PERMA_RS03815 succinyldiaminopimelate transaminase
Query= BRENDA::Q82IK5 (364 letters) >NCBI__GCF_000021565.1:WP_012675382.1 Length = 391 Score = 160 bits (406), Expect = 4e-44 Identities = 118/381 (30%), Positives = 175/381 (45%), Gaps = 35/381 (9%) Query: 8 LPTFPWDKLEPYKARAAAHPDGIVDLSVGTPVDPVPELIQKALV-AAADSPGYPTVWGTP 66 L +P ++L KA I D G P +P I++AL+ A + YP+V G Sbjct: 8 LKPYPMEELNRIKAELKDKGIKIYDFGTGDPKEPTDPKIRQALIDAVPEVSQYPSVAGRK 67 Query: 67 ELRDALTGWVERRLGARGVTHHHVLPIVGSKELVAWLPT---QLGLGPGDKVAHPRLAYP 123 ELR+A++ W R G + ++P GSKE + P + +KV AYP Sbjct: 68 ELREAVSRWFLNRFGVKLDPDSQIIPSNGSKEAIFHFPLVFIDTDIPEKNKVIFGTPAYP 127 Query: 124 TYEVGARLARADHVVYD--------------DPTELDPTGLKLLWLNSPSNPTGKVLSKA 169 YE G A V D + L+ T K++W+N P NPTG ++ Sbjct: 128 VYERGTLYAGGVPVPVPLREEDGFLLRLDKLDKSLLEET--KIVWINYPHNPTGATAPRS 185 Query: 170 ELTRIVAWAREHGILVFSDECYLELGWEADPVSVLHPDVCGGSYEGIVSVHSLSKRSNLA 229 + R++GI++ SDECY E+ + P+S L + EG+V HSLSKRS L Sbjct: 186 YFEEVYGICRDYGIILCSDECYTEIYYGEKPLSALQTGI-----EGVVVFHSLSKRSGLT 240 Query: 230 GYRAAFLAGDPAVLGPLLQIRKHGGMMTSAPTQAAVVAALGDDAHVREQRERYAARRTAL 289 GYR F+AGDP ++ + R G+ T Q A A D+ HV E+R+ + +R Sbjct: 241 GYRTGFIAGDPNLIKEYRKGRASFGVATPDFIQKAAEVAWSDEEHVEERRKIFNEKRKIF 300 Query: 290 RDALLSHGFRIEHSEASLYLW--ATRGESCWDTVAHLADLGILVAPGDFYGSAGE----- 342 + G + + EA+ Y W A G + + HL GI+V+PG + S E Sbjct: 301 IEFFDRIGLKYLYPEATFYFWIKAPDGMTGEEYAKHLLKYGIVVSPGVNFCSGIEILENR 360 Query: 343 ---QFVRVALTATDERVAAAV 360 ++ R+AL T E AV Sbjct: 361 CSSEYFRIALVPTVEECREAV 381 Lambda K H 0.319 0.135 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 422 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 364 Length of database: 391 Length adjustment: 30 Effective length of query: 334 Effective length of database: 361 Effective search space: 120574 Effective search space used: 120574 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_012675382.1 PERMA_RS03815 (succinyldiaminopimelate transaminase)
to HMM TIGR03537 (dapC: succinyldiaminopimelate transaminase (EC 2.6.1.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR03537.hmm # target sequence database: /tmp/gapView.24413.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03537 [M=350] Accession: TIGR03537 Description: DapC: succinyldiaminopimelate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.2e-181 586.9 0.0 7e-181 586.7 0.0 1.0 1 lcl|NCBI__GCF_000021565.1:WP_012675382.1 PERMA_RS03815 succinyldiaminopim Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000021565.1:WP_012675382.1 PERMA_RS03815 succinyldiaminopimelate transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 586.7 0.0 7e-181 7e-181 1 349 [. 29 386 .. 29 387 .. 0.99 Alignments for each domain: == domain 1 score: 586.7 bits; conditional E-value: 7e-181 TIGR03537 1 rlydfGtGdpkeptddfirkalldavpevsqypsvlGekalreaiagylerrfgvkldpdaevlpsaGs 69 ++ydfGtGdpkeptd+ ir+al+davpevsqypsv+G+k+lrea+++++ rfgvkldpd++++ps Gs lcl|NCBI__GCF_000021565.1:WP_012675382.1 29 KIYDFGTGDPKEPTDPKIRQALIDAVPEVSQYPSVAGRKELREAVSRWFLNRFGVKLDPDSQIIPSNGS 97 79******************************************************************* PP TIGR03537 70 keaifhlplafldpe.eerkkviygtpgypvyerGalfaggealkvklkkedgflleldaveeailret 137 keaifh+pl+f+d + +e++kvi+gtp+ypvyerG+l+agg +++v l++edgfll+ld++++++l+et lcl|NCBI__GCF_000021565.1:WP_012675382.1 98 KEAIFHFPLVFIDTDiPEKNKVIFGTPAYPVYERGTLYAGGVPVPVPLREEDGFLLRLDKLDKSLLEET 166 *************98457889************************************************ PP TIGR03537 138 kivwinyphnptGaeapasylkevaelareygiilasdecyaeiyseekpasvlevglenvlafhslsk 206 kivwinyphnptGa+ap+sy++ev ++r+ygiil+sdecy+eiy +ekp s+l+ g+e v++fhslsk lcl|NCBI__GCF_000021565.1:WP_012675382.1 167 KIVWINYPHNPTGATAPRSYFEEVYGICRDYGIILCSDECYTEIYYGEKPLSALQTGIEGVVVFHSLSK 235 ********************************************************************* PP TIGR03537 207 rsGmtGyrsgflaGdeelvsalrklrasvGvaspefvqaaataawsddahvaerrkifkrkrdlflefl 275 rsG+tGyr+gf+aGd++l++ +rk ras+Gva+p+f+q+aa+ awsd++hv+errkif++kr++f+ef+ lcl|NCBI__GCF_000021565.1:WP_012675382.1 236 RSGLTGYRTGFIAGDPNLIKEYRKGRASFGVATPDFIQKAAEVAWSDEEHVEERRKIFNEKRKIFIEFF 304 ********************************************************************* PP TIGR03537 276 akkGlealasdatfylwvkvpegidaksyalrlleeGivvapGeafgag........eeeyvrvalvpt 336 + Gl++l+++atfy+w+k+p+g+++++ya++ll+ Givv+pG +f++g ++ey+r+alvpt lcl|NCBI__GCF_000021565.1:WP_012675382.1 305 DRIGLKYLYPEATFYFWIKAPDGMTGEEYAKHLLKYGIVVSPGVNFCSGieilenrcSSEYFRIALVPT 373 ********************************************************************* PP TIGR03537 337 leeceeairlwer 349 +eec+ea+++we+ lcl|NCBI__GCF_000021565.1:WP_012675382.1 374 VEECREAVSVWEK 386 ***********98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (350 nodes) Target sequences: 1 (391 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.58 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory