Align Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 (characterized)
to candidate WP_012675980.1 PERMA_RS01125 prephenate dehydratase
Query= SwissProt::P27603 (365 letters) >NCBI__GCF_000021565.1:WP_012675980.1 Length = 361 Score = 293 bits (750), Expect = 5e-84 Identities = 156/366 (42%), Positives = 232/366 (63%), Gaps = 9/366 (2%) Query: 1 MSEADQLKALRVRIDSLDERILDLISERARCAQEVARVKTASWPKAEEAVFYRPEREAWV 60 M +L+ LR +ID +DE+IL L++ERA+ AQEV +K K Y P RE + Sbjct: 1 MDYKKKLEELRNKIDQIDEQILRLLNERAKLAQEVGHIK-----KEHNLPIYVPSREKAI 55 Query: 61 LKHIMELNK--GPL-DNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGH 117 + + +LN G + + + +FREI+S+C + E+ ++VAYLGP TF+ AA+KHFG Sbjct: 56 FERLEKLNAELGEIFPTDAVKPVFREIISACRSTEESIKVAYLGPRATFTHQAAIKHFGQ 115 Query: 118 SVISKPMAAIDEVFREVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIH 177 +V P++ I +VF E+V +FGVVPVEN+ EG VN+TLD +++ + I GEV L I Sbjct: 116 AVEHIPVSTIKDVFEEIVKEKADFGVVPVENTIEGIVNYTLDLLVDYPLKITGEVILEIS 175 Query: 178 HHLLVGETTKTDRITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSA 237 HL+ G I R+YSH +LA+CR WL + PN + + V S A AA+ K ++ SA Sbjct: 176 LHLM-GINPDVREIVRVYSHRHALAECRDWLRENLPNAQLIEVESTAKAAEMAKDDYESA 234 Query: 238 AIAGDMAAQLYGLSKLAEKIEDRPVNSTRFLIIGSQEVPPTGDDKTSIIVSMRNKPGALH 297 A+A + AA +YGL + KI+ N TRFL+IG+Q TG+DKT+ I S++N+ GAL+ Sbjct: 235 AVASEAAADIYGLHIIERKIDRHIHNFTRFLVIGTQIPNRTGNDKTTFIFSVKNEVGALY 294 Query: 298 ELLMPFHSNGIDLTRIETRPSRSGKWTYVFFIDCMGHHQDPLIKNVLEKIGHEAVALKVL 357 + L P + +GI++T+IE+RPS+ W Y+FF D GH QD ++ L+++ + K+L Sbjct: 295 KTLEPLYRHGINMTKIESRPSKKEAWDYIFFTDIEGHIQDERVEKALKELEEISPFFKIL 354 Query: 358 GSYPKA 363 GSYPKA Sbjct: 355 GSYPKA 360 Lambda K H 0.319 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 341 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 361 Length adjustment: 29 Effective length of query: 336 Effective length of database: 332 Effective search space: 111552 Effective search space used: 111552 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_012675980.1 PERMA_RS01125 (prephenate dehydratase)
to HMM PF01817 (CM_2)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/PF01817.25.hmm # target sequence database: /tmp/gapView.24297.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: CM_2 [M=79] Accession: PF01817.25 Description: Chorismate mutase type II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-30 90.9 2.0 3.3e-29 87.5 0.7 2.7 2 lcl|NCBI__GCF_000021565.1:WP_012675980.1 PERMA_RS01125 prephenate dehydra Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000021565.1:WP_012675980.1 PERMA_RS01125 prephenate dehydratase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 87.5 0.7 3.3e-29 3.3e-29 1 78 [. 11 90 .. 11 91 .. 0.93 2 ? 1.5 0.0 0.021 0.021 55 73 .. 117 135 .. 105 139 .. 0.78 Alignments for each domain: == domain 1 score: 87.5 bits; conditional E-value: 3.3e-29 CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlre.gaeel..gldpeavekifr 68 R++Id+iD+++l+Ll+eR++la+e++++Kke++lp++ p+Re++++erl++ + +el ++ +av+ +fr lcl|NCBI__GCF_000021565.1:WP_012675980.1 11 RNKIDQIDEQILRLLNERAKLAQEVGHIKKEHNLPIYVPSREKAIFERLEKlN-AELgeIFPTDAVKPVFR 80 99*************************************************63.45434799********* PP CM_2 69 eiisesralQ 78 eiis++r+ + lcl|NCBI__GCF_000021565.1:WP_012675980.1 81 EIISACRSTE 90 *******988 PP == domain 2 score: 1.5 bits; conditional E-value: 0.021 CM_2 55 elgldpeavekifreiise 73 ++++ ++++++f+ei++e lcl|NCBI__GCF_000021565.1:WP_012675980.1 117 VEHIPVSTIKDVFEEIVKE 135 4679999*********987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (79 nodes) Target sequences: 1 (361 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 8.42 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory