Align diaminopimelate decarboxylase (EC 4.1.1.20) (characterized)
to candidate WP_012676382.1 PERMA_RS06885 diaminopimelate decarboxylase
Query= BRENDA::Q9KVL7 (417 letters) >NCBI__GCF_000021565.1:WP_012676382.1 Length = 426 Score = 376 bits (965), Expect = e-109 Identities = 193/412 (46%), Positives = 277/412 (67%), Gaps = 5/412 (1%) Query: 3 YFNYQEDGQLWAEQVPLADLANQYGTPLYVYSRATLERHWHAFDKSVGDYPHLICYAVKA 62 YF Y+E+ QL+ E +P+ ++A++ GTP Y+YS+ + + K+ +Y LICYA KA Sbjct: 8 YFYYREN-QLFCENIPIKEIASKVGTPFYLYSKQAILDRIDQYKKAFEEYNTLICYAAKA 66 Query: 63 NSNLGVLNTLARLGSGFDIVSVGELERVLAAGGDPSKVVFSGVGKTEAEMKRALQLKIKC 122 NSNL +L G DIVS GEL + AG +K+V++GVGKT+ E++ A++ I Sbjct: 67 NSNLSILKIFEENDLGLDIVSGGELYKAKKAGFPSNKIVYAGVGKTDFELEYAIRENILS 126 Query: 123 FNVESEPELQRLNKVAGELGVKAPISLRINPDVDAKTHPYISTGLRDNKFGITFDRAAQV 182 FNVESE E+ L+++A +L IS+R+NPDVD KTHPYISTGLR +KFGI D A V Sbjct: 127 FNVESEMEIDVLDELAEKLNKTVRISIRVNPDVDPKTHPYISTGLRKSKFGIDIDEALNV 186 Query: 183 YRLAHSLPNLDVHGIDCHIGSQLTALAPFIDATDRLLALIDSLKAEGIHIRHLDVGGGLG 242 YR A N+DV GI CHIGSQ+ ++P+++A ++ L+ LK EGI ++H D+GGG+G Sbjct: 187 YRKAVKKKNIDVIGIHCHIGSQIMEISPYVEAVEKTAELVFRLKKEGIELQHFDIGGGIG 246 Query: 243 VVYR-DELPPQPSEYAKALLDRLERHRDLELIFEPGRAIAANAGVLVTKVEFLKHTEHKN 301 + YR ++ PP P + AKA++ + R L LI EPGR++ AG L+T+V FLK+ K+ Sbjct: 247 IRYRPEDNPPTPEDLAKAVIP-IVRTTGLRLIIEPGRSLIGEAGALITQVVFLKNKGDKH 305 Query: 302 FAIIDAAMNDLIRPALYQAWQDIIPLRPRQGEAQTYDLVGPVCETSDFLGKDRDL-VLQE 360 F I+D+ MNDL+RPA+Y A+ I+ + ++ + D+VGP+CET DF DR++ +Q Sbjct: 306 FIIVDSGMNDLLRPAMYNAYHHILSVEKKERKV-VADIVGPICETGDFFALDREIDDVQR 364 Query: 361 GDLLAVRSSGAYGFTMSSNYNTRPRVAEVMVDGNKTYLVRQREELSSLWALE 412 D LAV S+GAYG +MSSNYN RPR AEV+V N YL+++RE+ S + LE Sbjct: 365 KDYLAVMSAGAYGSSMSSNYNVRPRAAEVLVSDNSFYLIKEREDYSYITKLE 416 Lambda K H 0.319 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 437 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 417 Length of database: 426 Length adjustment: 32 Effective length of query: 385 Effective length of database: 394 Effective search space: 151690 Effective search space used: 151690 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_012676382.1 PERMA_RS06885 (diaminopimelate decarboxylase)
to HMM TIGR01048 (lysA: diaminopimelate decarboxylase (EC 4.1.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01048.hmm # target sequence database: /tmp/gapView.31962.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01048 [M=417] Accession: TIGR01048 Description: lysA: diaminopimelate decarboxylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-166 540.5 0.0 1.3e-166 540.2 0.0 1.0 1 lcl|NCBI__GCF_000021565.1:WP_012676382.1 PERMA_RS06885 diaminopimelate de Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000021565.1:WP_012676382.1 PERMA_RS06885 diaminopimelate decarboxylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 540.2 0.0 1.3e-166 1.3e-166 5 416 .. 12 416 .. 9 417 .. 0.98 Alignments for each domain: == domain 1 score: 540.2 bits; conditional E-value: 1.3e-166 TIGR01048 5 kdgeleiegvdlkelaeefgtPlYvydeetlrerlealkeafkaeeslvlYAvKAnsnlavlrllaeeG 73 ++ +l++e++++ke+a + gtP+Y+y+++++ r+ ++k+af+++++l++YA+KAnsnl++l++++e++ lcl|NCBI__GCF_000021565.1:WP_012676382.1 12 RENQLFCENIPIKEIASKVGTPFYLYSKQAILDRIDQYKKAFEEYNTLICYAAKANSNLSILKIFEEND 80 5679***************************************************************** PP TIGR01048 74 lgldvvsgGEleralaAgvkaekivfsgngkseeeleaaleleiklinvdsveelelleeiakelgkka 142 lgld+vsgGEl+ a++Ag++++kiv++g+gk++ ele a++ +i +nv+s++e++ l+e+a++l+k++ lcl|NCBI__GCF_000021565.1:WP_012676382.1 81 LGLDIVSGGELYKAKKAGFPSNKIVYAGVGKTDFELEYAIRENILSFNVESEMEIDVLDELAEKLNKTV 149 ********************************************************************* PP TIGR01048 143 rvllRvnpdvdaktheyisTGlkesKFGieveeaeeayelalkleslelvGihvHIGSqildlepfvea 211 r+++Rvnpdvd+kth+yisTGl++sKFGi+++ea+++y+ a+k+++++++Gih+HIGSqi++++p+vea lcl|NCBI__GCF_000021565.1:WP_012676382.1 150 RISIRVNPDVDPKTHPYISTGLRKSKFGIDIDEALNVYRKAVKKKNIDVIGIHCHIGSQIMEISPYVEA 218 ********************************************************************* PP TIGR01048 212 aekvvklleelkeegieleeldlGGGlgisyeeeeeapdleeyaeklleklekeaelglklklilEpGR 280 +ek ++l+ +lk+egiel+++d+GGG+gi+y++e+++p++e++a++++ ++ + l+li+EpGR lcl|NCBI__GCF_000021565.1:WP_012676382.1 219 VEKTAELVFRLKKEGIELQHFDIGGGIGIRYRPEDNPPTPEDLAKAVIPIVRT-----TGLRLIIEPGR 282 *************************************************9999.....599******** PP TIGR01048 281 slvanagvlltrVesvKevesrkfvlvDagmndliRpalYeayheiaalkrleeeetetvdvvGplCEs 349 sl+++ag l+t+V ++K+++ ++f++vD+gmndl+Rpa+Y+ayh+i +++ +e+++++d+vGp+CE+ lcl|NCBI__GCF_000021565.1:WP_012676382.1 283 SLIGEAGALITQVVFLKNKGDKHFIIVDSGMNDLLRPAMYNAYHHILSVEK--KERKVVADIVGPICET 349 *************************************************66..6668************ PP TIGR01048 350 gDvlakdrelpeveeGdllavasaGAYgasmssnYnsrprpaevlveegkarlirrretledllale 416 gD++a dre+++v++ d+lav+saGAYg smssnYn rpr+aevlv++++ +li++re ++ + +le lcl|NCBI__GCF_000021565.1:WP_012676382.1 350 GDFFALDREIDDVQRKDYLAVMSAGAYGSSMSSNYNVRPRAAEVLVSDNSFYLIKEREDYSYITKLE 416 *************************************************************999876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (417 nodes) Target sequences: 1 (426 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.06 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory