Align Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 (uncharacterized)
to candidate WP_012676517.1 PERMA_RS04400 diaminopimelate decarboxylase
Query= curated2:O27390 (428 letters) >NCBI__GCF_000021565.1:WP_012676517.1 Length = 451 Score = 174 bits (442), Expect = 4e-48 Identities = 128/423 (30%), Positives = 202/423 (47%), Gaps = 22/423 (5%) Query: 15 IGGADAVELADEYGTPLYVIDEMRIRENYRRLYRAFSGEYSRFQVFYACKANTNLAVMRI 74 I G EL + YG+PL+VI E ++RE YR++Y AFS Y Q ++ K N AV + Sbjct: 35 IDGVPVSELVERYGSPLFVISERKLRERYRKIYNAFSSRYPNVQFGWSYKTNYLKAVCSV 94 Query: 75 LEEEGSGIDAVSPGEIYTALMAGFDPDRILYTGNNVRDDELQFALDSGVRINVDSRSQLL 134 L +EG+ + VS E A G D I++ G + D L+ A G I++D +++ Sbjct: 95 LHQEGAIAEVVSAFEYEKARNLGIDGKNIIFNGPHKTLDILEKAASEGAMIHIDHFDEII 154 Query: 135 RLSEIAP---EGLRISFRVNPLVGAGHHEHCITGGEMSKFGVMEREAPEVYRMAMDLGFE 191 L +IA + ++++ RVN + G H G + G + V R+A Sbjct: 155 DLEKIADRLGKKIKVAIRVN--MDTGIHPQWDRFGFNLETG---QALDAVKRIATGGKLV 209 Query: 192 PVGIHAHIGSGILDPEPFMLAVETLMDIAGRVHEATGVEFEFIDFGGGL-------GIPY 244 G+H+HIG+ IL+PE + VE L+ +A + + G + E++D GGG G Sbjct: 210 LNGLHSHIGTFILEPEAYGKEVEKLVKLAYEIEDNFGFKIEYLDIGGGFPSKNKLKGTYL 269 Query: 245 TPEEEPLDIDEFASKITGLFKDKLSEYGLGRPMMCLEPGRYIVGDASYLLTRVNTIKE-- 302 P+ ++E+A KIT L P + LE GR I+ +A YL+T + K Sbjct: 270 PPDVLVPSVEEYAEKITEALYSNLRPGDF--PKLILETGRAIIDEAEYLITTIFASKRLP 327 Query: 303 SYRKFAGVDAGFNTLLRPAMYGSYHHILVAERPLDEPSEKMDVAGNVCESGDLFARDRQL 362 RK DAG N L Y I +R + +E + G +C + D+ L Sbjct: 328 DGRKAYIADAGVNILFTAFWYKFNIEI---DREVQGTNEPSVIYGPLCMNIDVIDDGTML 384 Query: 363 PEINEGDVLAIMNAGAYSFSMSSQYNSRPRPAEVLVREGKVDVVRERETFSDLLRGQNVP 422 P + G L I GAY+ + Q+ +++ +G V++VRERE SD+ R + +P Sbjct: 385 PPLERGTRLIISPVGAYNNTQWMQFIEYRPNVVMIMEDGSVEIVREREDISDIERRERLP 444 Query: 423 ARL 425 +L Sbjct: 445 EKL 447 Lambda K H 0.320 0.140 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 536 Number of extensions: 28 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 428 Length of database: 451 Length adjustment: 32 Effective length of query: 396 Effective length of database: 419 Effective search space: 165924 Effective search space used: 165924 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory