Align cystathionine gamma-lyase (EC 4.4.1.1) (characterized)
to candidate WP_012755917.1 RLEG_RS00965 O-succinylhomoserine sulfhydrylase
Query= BRENDA::Q5H4T8 (397 letters) >NCBI__GCF_000023185.1:WP_012755917.1 Length = 394 Score = 248 bits (634), Expect = 2e-70 Identities = 149/384 (38%), Positives = 224/384 (58%), Gaps = 10/384 (2%) Query: 18 ATLAIHGG----QSPDPSTGAVMPP--IYATSTYAQSS-PGEHQGFEYSRTHNPTRFAYE 70 AT +HGG Q + S + +Y TS A++ GE +GF Y+R +PT +E Sbjct: 8 ATQLVHGGTLRSQYGETSEAIYLTQGFVYETSEAAEARFKGETEGFIYARYGSPTNDMFE 67 Query: 71 RCVAALEGGTRAFAFASGMAA-TSTVMELLDAGSHVVAMDDLYGGTFRLFERVRRRTAGL 129 + + LEG A A ASGMAA T+ ++ L +G H+VA L+G + E + + G+ Sbjct: 68 KRMCMLEGAEDARATASGMAAVTAAILCQLKSGDHIVAARALFGSCRWVVETLAPKY-GI 126 Query: 130 DFSFVDLTDPAAFKAAIRADTKMVWIETPTNPMLKLVDIAAIAVIARKHGLLTVVDNTFA 189 D + +D D A ++ AI TK+ ++E+PTNP L+++DIA +A +A + G VVDN FA Sbjct: 127 DCTLIDGRDLANWEKAITPKTKVFFLESPTNPTLEVIDIAGVAKLANQVGAKVVVDNVFA 186 Query: 190 SPMLQRPLSLGADLVVHSATKYLNGHSDMVGGIAVVGDNAELAEQMAFLQNSIGGVQGPF 249 +P+ Q+PL LGA +VV+SATK+++G +GG+ V+ D + E + G PF Sbjct: 187 TPLFQKPLELGAHIVVYSATKHIDGQGRCLGGV-VLSDKEWIDENLHDYFRHTGPAMSPF 245 Query: 250 DSFLALRGLKTLPLRMRAHCENALALAQWLETHPAIEKVIYPGLASHPQHVLAKRQMSGF 309 +++ L+G++TLPLR+R ENA +A +L + KVIYPG HPQ + +QM+G Sbjct: 246 NAWTLLKGIETLPLRVRQQTENAAKIADFLAEQGKVAKVIYPGRKDHPQADIIAKQMTGG 305 Query: 310 GGIVSIVLKGGFDAAKRFCEKTELFTLAESLGGVESLVNHPAVMTHASIPVARREQLGIS 369 +V+ LKGG DAA ++ ++ +LG +SL+ HPA TH ++ R +LGIS Sbjct: 306 STLVAFELKGGKDAAFALQNALDIVKISNNLGDSKSLITHPATTTHKNLTDEARAELGIS 365 Query: 370 DALVRLSVGIEDLGDLRGDLERAL 393 VRLS GIED DL D +AL Sbjct: 366 PGTVRLSAGIEDTDDLIEDFAKAL 389 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 405 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 394 Length adjustment: 31 Effective length of query: 366 Effective length of database: 363 Effective search space: 132858 Effective search space used: 132858 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory