Align Aromatic-amino-acid aminotransferase 1; ARAT-I; AROAT; EC 2.6.1.57 (characterized)
to candidate WP_012758180.1 RLEG_RS13530 PLP-dependent aminotransferase family protein
Query= SwissProt::H3ZPL1 (417 letters) >NCBI__GCF_000023185.1:WP_012758180.1 Length = 405 Score = 300 bits (768), Expect = 5e-86 Identities = 172/411 (41%), Positives = 239/411 (58%), Gaps = 20/411 (4%) Query: 16 LDYEKYFSEKALGMKASEIRELLKLVETSDVISLAGGLPAPETFPVEIIGEITKEVLEKH 75 L+++ F+ ++ M+ASEIRELLKL++ D+IS AGG+P P FP + + ++ Sbjct: 2 LNWDTMFASRSSRMRASEIRELLKLLDRPDIISFAGGIPDPALFPDQEFKQAYADIFAAA 61 Query: 76 AAQALQYGTTKGFTPLRLALAEWM---RERYDIPISKVDIMTTSGSQQALDLIGRVFINP 132 ALQY ++G+ PLR EW+ IP ++ SGSQQ LD +G++F++P Sbjct: 62 VNSALQYSVSEGYKPLR----EWLVGQMAALGIPCELDNVFIVSGSQQGLDYLGKLFLSP 117 Query: 133 GDIIVVEAPTYLAALQAFKYYEPEFVQIPLDDEGMNVDLLEEKLQELEKEGKKVKIVYTI 192 D +V PTYL ALQAF YEP + Q L G + G KVK Y Sbjct: 118 DDTALVTWPTYLGALQAFNAYEPAYDQ--LTPNGNRTP--DSYRSAASTAGGKVKFAYLS 173 Query: 193 PTFQNPAGVTMNEKRRKRLLELASQYDFIIVEDNPYGELRYSGEPVKPIKAWD--EEG-- 248 F NP G T++ RK++L LA D ++ED Y LRY G+P+ PI A + E+G Sbjct: 174 ADFSNPTGETVDLDGRKKVLALAEDLDIAVIEDAAYQSLRYDGDPIPPILALEIAEKGHI 233 Query: 249 ---RVIYLGTFSKILAPGFRIGWIAAEPHFIRKLEIAKQSVDLCTNTFSQVIAWKYVEGG 305 R IY G+FSK LAPG R+G+I A IRKL + KQ+ DL ++T +Q+ E G Sbjct: 234 NDTRTIYCGSFSKTLAPGLRVGFIVANAPVIRKLVLMKQAADLHSSTINQMAISDVAERG 293 Query: 306 YLDKHIPKIIEFYKPRRDAMLKALEEFMPDGVKWTKPEGGMFVWATLPEGID-TKLMLEK 364 + D + KI Y RRD ML AL+++MP+G WTKPEGGMF+W TLPEG+D KL+ + Sbjct: 294 F-DAQVAKIKAAYSQRRDCMLTALDKYMPEGTSWTKPEGGMFIWITLPEGMDGAKLLAKS 352 Query: 365 AVAKGVAYVPGEAFFAHRDVKNTMRLNFTYVPEEKIREGIKRLAETIKEEM 415 VA+VPG+AFFA NT+RL+F+ E+ I +GI RL+ I E+ Sbjct: 353 LETAKVAFVPGKAFFADGSGANTIRLSFSCANEQMIEDGIGRLSALISAEI 403 Lambda K H 0.318 0.137 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 416 Number of extensions: 21 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 417 Length of database: 405 Length adjustment: 31 Effective length of query: 386 Effective length of database: 374 Effective search space: 144364 Effective search space used: 144364 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory