Align Branched-chain amino acid aminotransferase (EC 2.6.1.42) (characterized)
to candidate WP_012758181.1 RLEG_RS13535 branched-chain amino acid aminotransferase
Query= reanno::Cup4G11:RR42_RS25890 (363 letters) >NCBI__GCF_000023185.1:WP_012758181.1 Length = 366 Score = 462 bits (1188), Expect = e-135 Identities = 224/360 (62%), Positives = 264/360 (73%), Gaps = 3/360 (0%) Query: 1 MTQQTT---FSLEPNPNALDAATRDALMRDPAFGRVFTDHMVTITWREGQGWQDAKVTAR 57 MT TT +E + + + A R + P FG+VFTDHMV W +GW DAKVT R Sbjct: 1 MTATTTSPEIKIELHKSPVSDADRIQALETPGFGKVFTDHMVLARWTADKGWHDAKVTPR 60 Query: 58 KPFSIDPACSVLHYGQEIFEGMKAYRGADGAVTLFRPLENARRFQASAKRMAMPALPESL 117 +P +DPA +VLHY QEIFEGMKAY+ DG + LFRP ENARRF SA RMAMP +PE L Sbjct: 61 RPLELDPASAVLHYAQEIFEGMKAYKADDGRILLFRPEENARRFAQSATRMAMPPVPEEL 120 Query: 118 FLEAIEQLVRIDQAWVPHGSGSLYLRPFMFANEVFLGIKPASEFIFCVIACPVGPYFKGG 177 FL+A+E+LVR+D+AW+P G SLYLRPFMFANE FLG++PA E++FC+IA PVG YFKGG Sbjct: 121 FLKAVEELVRVDKAWIPSGDASLYLRPFMFANEAFLGVRPAQEYVFCIIASPVGAYFKGG 180 Query: 178 DKAVSVWVSENYTRAAPGGTGEAKCGGNYAGSLVAQNEATANGCDQVVFLDAAEHRWVEE 237 KAVS+WV YTRAA GGTG AKCGGNYA SLVAQ EA CDQVVFLDAAEHRWVEE Sbjct: 181 AKAVSLWVETEYTRAAAGGTGAAKCGGNYAASLVAQAEAAKKDCDQVVFLDAAEHRWVEE 240 Query: 238 LGGMNIFFVMDDGTLVTPPLSGSILPGITRASVIELAREMGMVVEERRYSYPEWEADAKS 297 LGGMN+FFVM+DG++VTPPL G+ILPGITRASVI LA E G+ VE+R YS+ EW+ DA S Sbjct: 241 LGGMNVFFVMNDGSVVTPPLGGTILPGITRASVIVLAGEKGLRVEQRPYSFAEWQQDATS 300 Query: 298 GRLAEAFVCGTAATLVAIGEVRSARTRFAIGNGTAGNTVKVLRDRLVEIQRNQAAGPAGW 357 G+L EAF CGTAA L IG VR A F +G+G G LR +LV +Q+ GW Sbjct: 301 GKLVEAFACGTAAVLAGIGLVRHAGGEFLVGDGQTGKLTSELRQQLVSLQKGVTNDERGW 360 Lambda K H 0.321 0.135 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 454 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 366 Length adjustment: 29 Effective length of query: 334 Effective length of database: 337 Effective search space: 112558 Effective search space used: 112558 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
Align candidate WP_012758181.1 RLEG_RS13535 (branched-chain amino acid aminotransferase)
to HMM TIGR01123 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01123.hmm # target sequence database: /tmp/gapView.6482.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01123 [M=313] Accession: TIGR01123 Description: ilvE_II: branched-chain amino acid aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-128 413.1 0.0 3.6e-128 412.9 0.0 1.0 1 lcl|NCBI__GCF_000023185.1:WP_012758181.1 RLEG_RS13535 branched-chain amin Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000023185.1:WP_012758181.1 RLEG_RS13535 branched-chain amino acid aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 412.9 0.0 3.6e-128 3.6e-128 1 310 [. 52 361 .. 52 364 .. 0.99 Alignments for each domain: == domain 1 score: 412.9 bits; conditional E-value: 3.6e-128 TIGR01123 1 WdeaelaseaeleldegsavlhYgqevfeGlkayRtadGkillfRpdanakRlrrsaerlllPeleeel 69 W++a++++ +leld++savlhY+qe+feG+kay+ +dG+illfRp++na+R+ +sa r+++P ++eel lcl|NCBI__GCF_000023185.1:WP_012758181.1 52 WHDAKVTPRRPLELDPASAVLHYAQEIFEGMKAYKADDGRILLFRPEENARRFAQSATRMAMPPVPEEL 120 ********************************************************************* PP TIGR01123 70 flealkqlvkadkdwvpkakseasLYlRPfliatednlGvkaakeylflvlasPvGaYfkgglapvsif 138 fl+a+++lv++dk+w+p+ ++asLYlRPf++a e+ lGv++a+ey+f+++asPvGaYfkgg + vs + lcl|NCBI__GCF_000023185.1:WP_012758181.1 121 FLKAVEELVRVDKAWIPS--GDASLYLRPFMFANEAFLGVRPAQEYVFCIIASPVGAYFKGGAKAVSLW 187 *****************4..56*********************************************** PP TIGR01123 139 veteyvRaapkGtGavkvgGnYaasllaqkkaaeqglddvvyldpvekkkieevGaaniflitkdgelv 207 vetey+Raa +GtGa+k+gGnYaasl aq++aa++ +d+vv+ld++e++ +ee+G++n+f++++dg++v lcl|NCBI__GCF_000023185.1:WP_012758181.1 188 VETEYTRAAAGGTGAAKCGGNYAASLVAQAEAAKKDCDQVVFLDAAEHRWVEELGGMNVFFVMNDGSVV 256 ********************************************************************* PP TIGR01123 208 ttplsesiLegvtresllelakdlgleveereiaidelkaaveaGei..vfacGtaavitPvgelkieg 274 t+pl + iL+g+tr+s++ la + gl+ve r + e+++ +++G++ +facGtaav++ +g +++ g lcl|NCBI__GCF_000023185.1:WP_012758181.1 257 TPPLGGTILPGITRASVIVLAGEKGLRVEQRPYSFAEWQQDATSGKLveAFACGTAAVLAGIGLVRHAG 325 *********************************************99889******************* PP TIGR01123 275 kevevkseevGevtkklrdeltdiqyGkledkegWi 310 e+ v ++++G++t +lr++l+++q G ++d+ gW+ lcl|NCBI__GCF_000023185.1:WP_012758181.1 326 GEFLVGDGQTGKLTSELRQQLVSLQKGVTNDERGWT 361 ***********************************7 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (313 nodes) Target sequences: 1 (366 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 8.14 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory