Align N-acetyl-gamma-glutamyl-phosphate reductase; Short=AGPR; EC 1.2.1.38 (characterized, see rationale)
to candidate WP_012779335.1 TERTU_RS13580 N-acetyl-gamma-glutamyl-phosphate reductase
Query= uniprot:E4PLW0 (388 letters) >NCBI__GCF_000023025.1:WP_012779335.1 Length = 346 Score = 439 bits (1130), Expect = e-128 Identities = 219/349 (62%), Positives = 268/349 (76%), Gaps = 7/349 (2%) Query: 44 VIKVGIVGGTGYTGVELLRILAVHPEVSVSCITSRSEAGMPVAEMYPNLRGHYD-LAFSE 102 +IKVGIVGGTGYTGVELLR+LAVHP+V V+ ITSR+EAG V E++P LRGHYD L FSE Sbjct: 1 MIKVGIVGGTGYTGVELLRLLAVHPKVEVTLITSRAEAGKCVTELFPTLRGHYDDLYFSE 60 Query: 103 PDVNVLGACDLVFFATPHGVAMRMVPELMSAGVRVVDLSADFRLKDLDVWANWYGMAHES 162 P+ + LGACDLVFFATPHGVA M+ E+++AGVR +DLSADFR++D++VW WYG H Sbjct: 61 PESHALGACDLVFFATPHGVAQAMMKEVLAAGVRAIDLSADFRIRDIEVWEKWYGQQHGC 120 Query: 163 PEWAEKAVYGLPEVVRDEIRNAQLVANPGCYPTAVQLGFLPLLEQGLVDPKRLIADAKSG 222 PE +AVYGLPE+ R++I++AQLVA PGCYPT++QLGF PLL L+DP+ LIA + SG Sbjct: 121 PELVAQAVYGLPEIHREQIKDAQLVACPGCYPTSIQLGFYPLLANDLIDPRSLIASSASG 180 Query: 223 ASGAGRQGKIGMLHGEIGESFKAYGASGHRHLPEIRQGLCGAAGGDVG---VTFVPHLIP 279 SGAG+Q K+ +L E+GESFK Y A GHRHLPEI QGL D +TFVPHL+P Sbjct: 181 VSGAGKQAKVDLLMAEMGESFKTYAAGGHRHLPEIEQGLRDMQTPDAAEPELTFVPHLLP 240 Query: 280 MIRGIEATLYAELKNPADFDRLQALFEQRFDDEPFVDVMPFGSHPETRSVRGANQCRMAL 339 MIRGI +TL+A L D LQALFE + +EPFVDV+P G PETRSV+ +N CR+A+ Sbjct: 241 MIRGIHSTLFARLIENVD---LQALFEDFYANEPFVDVLPQGVLPETRSVKSSNICRLAV 297 Query: 340 HRQEQSNIVIVSSVIDNLVKGAAGQAVQNMNIMFGLKETMGLEAPALLP 388 + V+V+SVIDNL KGA+GQ +QNMNIMFG ETMGL APALLP Sbjct: 298 LEPQSRGTVVVASVIDNLTKGASGQGIQNMNIMFGFDETMGLAAPALLP 346 Lambda K H 0.321 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 439 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 346 Length adjustment: 30 Effective length of query: 358 Effective length of database: 316 Effective search space: 113128 Effective search space used: 113128 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_012779335.1 TERTU_RS13580 (N-acetyl-gamma-glutamyl-phosphate reductase)
to HMM TIGR01850 (argC: N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01850.hmm # target sequence database: /tmp/gapView.18486.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01850 [M=345] Accession: TIGR01850 Description: argC: N-acetyl-gamma-glutamyl-phosphate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-129 417.5 0.0 2.6e-129 417.3 0.0 1.0 1 lcl|NCBI__GCF_000023025.1:WP_012779335.1 TERTU_RS13580 N-acetyl-gamma-glu Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000023025.1:WP_012779335.1 TERTU_RS13580 N-acetyl-gamma-glutamyl-phosphate reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 417.3 0.0 2.6e-129 2.6e-129 1 345 [] 2 346 .] 2 346 .] 0.96 Alignments for each domain: == domain 1 score: 417.3 bits; conditional E-value: 2.6e-129 TIGR01850 1 ikvaivGasGYtGaeLlrllakHpevevtklvssreagkklsevhphlkglvd.lkleeleeeeileea 68 ikv+ivG++GYtG+eLlrlla Hp+vevt ++s+ eagk ++e++p+l+g++d l ++e e+++l ++ lcl|NCBI__GCF_000023025.1:WP_012779335.1 2 IKVGIVGGTGYTGVELLRLLAVHPKVEVTLITSRAEAGKCVTELFPTLRGHYDdLYFSEP-ESHALGAC 69 69***************************6666666*****************6666655.555778** PP TIGR01850 69 dvvflAlphgvsaelvpellekgvkvidlSadfRlkdaevYekwYgkkhekeelleeavYGlpElnree 137 d+vf+A+phgv++++++e+l++gv+ idlSadfR++d ev+ekwYg++h +el+++avYGlpE++re+ lcl|NCBI__GCF_000023025.1:WP_012779335.1 70 DLVFFATPHGVAQAMMKEVLAAGVRAIDLSADFRIRDIEVWEKWYGQQHGCPELVAQAVYGLPEIHREQ 138 ********************************************************************* PP TIGR01850 138 ikkaklianPGCyaTaalLalaPllkekliepksiivdaksGvSgAGrkasekslfaevnenlkpYkvt 206 ik+a+l+a+PGCy+T+++L+ +Pll+++li+p+s+i + sGvSgAG++a+ + l+ae+ e++k Y++ lcl|NCBI__GCF_000023025.1:WP_012779335.1 139 IKDAQLVACPGCYPTSIQLGFYPLLANDLIDPRSLIASSASGVSGAGKQAKVDLLMAEMGESFKTYAAG 207 ********************************************************************* PP TIGR01850 207 kHrHtpEieqelsklaek...kvkvsftphlvpmtrGilatiyaklkkelteeelrklyeevYedepfv 272 +HrH pEieq l+++++ + +++f+phl+pm+rGi++t+ a+l +++ +l++l+e++Y++epfv lcl|NCBI__GCF_000023025.1:WP_012779335.1 208 GHRHLPEIEQGLRDMQTPdaaEPELTFVPHLLPMIRGIHSTLFARLIENV---DLQALFEDFYANEPFV 273 *************99876666778*********************99865...9*************** PP TIGR01850 273 rvlkegelPstkavlgsnfvdigvavdeetkrvvvvsaiDNLvKGaagqAvqnlNlmlgfdetegLekl 341 +vl++g lP+t++v sn ++++v ++ ++vvv s+iDNL+KGa+gq +qn+N+m+gfdet gL lcl|NCBI__GCF_000023025.1:WP_012779335.1 274 DVLPQGVLPETRSVKSSNICRLAVLEPQSRGTVVVASVIDNLTKGASGQGIQNMNIMFGFDETMGLAAP 342 ******************************************************************999 PP TIGR01850 342 pllp 345 +llp lcl|NCBI__GCF_000023025.1:WP_012779335.1 343 ALLP 346 8877 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (345 nodes) Target sequences: 1 (346 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 7.27 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory