Align D-3-phosphoglycerate dehydrogenase; PGDH; EC 1.1.1.95 (uncharacterized)
to candidate WP_012850833.1 TCUR_RS02200 C-terminal binding protein
Query= curated2:O27051 (525 letters) >NCBI__GCF_000024385.1:WP_012850833.1 Length = 321 Score = 178 bits (451), Expect = 3e-49 Identities = 108/307 (35%), Positives = 169/307 (55%), Gaps = 7/307 (2%) Query: 8 IADSINEKGISELEEVAEVV-VNTTITPEELLDAIKDFDAIVVRSRTKVTREVIEAAPRL 66 + D+ G+ LEE V + P +++ A D DA+++ ++ R ++EA P + Sbjct: 11 VVDTDPAPGVKLLEEAGFTVRFAASAAPADIVAAAADADALLL-GYAEIDRPLLEALPAV 69 Query: 67 KIIARAGVGVDNVDVKAATDRGIMVINAPESTSITVAEHSIGLMLALARKIAIADRSVKE 126 +I+A VG D VD+ A +RGI V N P + + VA H++ + LAL R + DR V+ Sbjct: 70 RIVATQSVGYDMVDLDACRERGIWVTNVPGAATEEVASHALAMTLALLRGLPYLDRDVRA 129 Query: 127 GKWEKNRFMGIELNGKTLGIIGMGRIGSQVVVRTKAFGMDIMVYDPYISKEAAEEMGVTV 186 G W+ R L+ T+G++G+GRIG + + I+ YDP ++ GV Sbjct: 130 GIWDGTRHDLRRLSEVTVGVVGLGRIGRRYAEYVRPLVGRIVGYDPAVT----AMHGVQW 185 Query: 187 TDLETLLRESDIVTIHVPLTPETRHLISEDEFKLMKDTAFIVNCARGGIIDEDALYRALK 246 L+ LL SD+V++H+PLT ETR L+ LM++ A +VN +R G+ID AL R L Sbjct: 186 LALDELLACSDVVSLHLPLTAETRGLLDARRLGLMREGASLVNVSRAGLIDHRALVRCLD 245 Query: 247 DGEIAGAALDVFEEEPPE-GSPLLELENVVLTPHIGASTSEAQRDAAIIVANEIKTVFQG 305 +G ++GAALDV +EPPE G P+L V+LTPH ++ + RD + A + Sbjct: 246 EGRLSGAALDVLPQEPPEPGDPILAHPRVLLTPHAAYLSAASSRDYVLQQAENVVLWHAR 305 Query: 306 GAPRNVL 312 G P +V+ Sbjct: 306 GRPVSVV 312 Lambda K H 0.316 0.135 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 336 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 525 Length of database: 321 Length adjustment: 31 Effective length of query: 494 Effective length of database: 290 Effective search space: 143260 Effective search space used: 143260 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory