Align phosphoserine transaminase (EC 2.6.1.52) (characterized)
to candidate WP_012851206.1 TCUR_RS04095 phosphoserine transaminase
Query= BRENDA::P9WQ73 (376 letters) >NCBI__GCF_000024385.1:WP_012851206.1 Length = 370 Score = 503 bits (1294), Expect = e-147 Identities = 244/366 (66%), Positives = 293/366 (80%), Gaps = 1/366 (0%) Query: 11 IPTAIKPRDGRFGSGPSKVRLEQLQTLTTTAAALFGTSHRQAPVKNLVGRVRSGLAELFS 70 IP +KP DGRFG GPSKVR EQL+ L + AA GTSHRQAPVK+LV RVR GLAELFS Sbjct: 6 IPADLKPADGRFGCGPSKVRPEQLRALAESGAAYLGTSHRQAPVKSLVRRVREGLAELFS 65 Query: 71 LPDGYEVILGNGGATAFWDAAAFGLIDKRSLHLTYGEFSAKFASAVSKNPFVGEPIIITS 130 LP+GY V+L NGG TAFWDAAAFGLI ++S HLT+GEFS+KFA P++ EP +I++ Sbjct: 66 LPEGYRVLLSNGGTTAFWDAAAFGLIRRKSQHLTFGEFSSKFAKVAKAAPWLEEPSLISA 125 Query: 131 DPGSAPEPQTDPSVDVIAWAHNETSTGVAVAVRRPEGSDDALVVIDATSGAGGLPVDIAE 190 +PGS P P+ + VDV A HNETSTGVA+ ++R G +D+LV++DATSGAGGLPVDI + Sbjct: 126 EPGSHPLPRAEDGVDVYALTHNETSTGVAMPIQRV-GGEDSLVLVDATSGAGGLPVDITQ 184 Query: 191 TDAYYFAPQKNFASDGGLWLAIMSPAALSRIEAIAATGRWVPDFLSLPIAVENSLKNQTY 250 D YYFAPQK FASDGGLW+A++SPAAL RIE IA++ R++P+F +L ++NS K+QTY Sbjct: 185 ADVYYFAPQKCFASDGGLWVALVSPAALERIEQIASSDRYIPEFFNLKTVIDNSAKDQTY 244 Query: 251 NTPAIATLALLAEQIDWLVGNGGLDWAVKRTADSSQRLYSWAQERPYTTPFVTDPGLRSQ 310 NTPA+ATL L AEQI+W+ GGL W RTADS+QRLY+WA++ Y TPFV DP RSQ Sbjct: 245 NTPAVATLLLFAEQIEWMNAQGGLAWTTARTADSAQRLYTWAEKSSYATPFVADPAQRSQ 304 Query: 311 VVGTIDFVDDVDAGTVAKILRANGIVDTEPYRKLGRNQLRVAMFPAVEPDDVSALTECVD 370 VVGTIDFVD VDA VAK LRANGIVDTEPYRKLGRNQLR+ MFPAV+P DV ALT C+D Sbjct: 305 VVGTIDFVDSVDAAAVAKTLRANGIVDTEPYRKLGRNQLRIGMFPAVDPADVEALTACID 364 Query: 371 WVVERL 376 +VVERL Sbjct: 365 YVVERL 370 Lambda K H 0.317 0.134 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 489 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 376 Length of database: 370 Length adjustment: 30 Effective length of query: 346 Effective length of database: 340 Effective search space: 117640 Effective search space used: 117640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_012851206.1 TCUR_RS04095 (phosphoserine transaminase)
to HMM TIGR01366 (putative phosphoserine aminotransferase (EC 2.6.1.52))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01366.hmm # target sequence database: /tmp/gapView.28136.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01366 [M=361] Accession: TIGR01366 Description: serC_3: putative phosphoserine aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-206 671.0 0.1 2.5e-206 670.9 0.1 1.0 1 lcl|NCBI__GCF_000024385.1:WP_012851206.1 TCUR_RS04095 phosphoserine trans Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000024385.1:WP_012851206.1 TCUR_RS04095 phosphoserine transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 670.9 0.1 2.5e-206 2.5e-206 1 361 [] 11 370 .] 11 370 .] 0.99 Alignments for each domain: == domain 1 score: 670.9 bits; conditional E-value: 2.5e-206 TIGR01366 1 kpadgrfgagpskvrleqlqalvataasllgtshrqaavknlvgkvreglaelfslpdgyevilgngga 69 kpadgrfg+gpskvr+eql al++++a+ lgtshrqa+vk lv +vreglaelfslp+gy v+l+ngg+ lcl|NCBI__GCF_000024385.1:WP_012851206.1 11 KPADGRFGCGPSKVRPEQLRALAESGAAYLGTSHRQAPVKSLVRRVREGLAELFSLPEGYRVLLSNGGT 79 7******************************************************************** PP TIGR01366 70 tafwdaatfgliekkslhlsfgefsskfakaaklapfldepeivtadpgsapeaqaeegvdvialahne 138 tafwdaa+fgli +ks+hl+fgefsskfak ak ap+l+ep +++a+pgs+p ++ae+gvdv+al+hne lcl|NCBI__GCF_000024385.1:WP_012851206.1 80 TAFWDAAAFGLIRRKSQHLTFGEFSSKFAKVAKAAPWLEEPSLISAEPGSHPLPRAEDGVDVYALTHNE 148 ********************************************************************* PP TIGR01366 139 tstgvavavrrpegsdealvvidatsgagglpvdiketdvyyfapqksfasdgglwlavlspaalerie 207 tstgva++++r+ +++lv++datsgagglpvdi+++dvyyfapqk+fasdgglw+a++spaalerie lcl|NCBI__GCF_000024385.1:WP_012851206.1 149 TSTGVAMPIQRVG-GEDSLVLVDATSGAGGLPVDITQADVYYFAPQKCFASDGGLWVALVSPAALERIE 216 ***********95.5889*************************************************** PP TIGR01366 208 kiaasgrfvpeflslptavdnslknqtyntpavatlllldeqvdwlngnggldfavartkdsssrlysw 276 +ia+s+r++pef++l+t +dns k+qtyntpavatlll++eq++w+n++ggl +++art+ds++rly+w lcl|NCBI__GCF_000024385.1:WP_012851206.1 217 QIASSDRYIPEFFNLKTVIDNSAKDQTYNTPAVATLLLFAEQIEWMNAQGGLAWTTARTADSAQRLYTW 285 ********************************************************************* PP TIGR01366 277 aeereyatpfvadaakrsqvvgtidfsddidaavvakilrangivdtepyrklgrnqlrvamfpaidpa 345 ae++ yatpfvad+a+rsqvvgtidf+d++daa+vak lrangivdtepyrklgrnqlr++mfpa+dpa lcl|NCBI__GCF_000024385.1:WP_012851206.1 286 AEKSSYATPFVADPAQRSQVVGTIDFVDSVDAAAVAKTLRANGIVDTEPYRKLGRNQLRIGMFPAVDPA 354 ********************************************************************* PP TIGR01366 346 dvealteavdfvvekl 361 dvealt ++d+vve+l lcl|NCBI__GCF_000024385.1:WP_012851206.1 355 DVEALTACIDYVVERL 370 **************86 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (361 nodes) Target sequences: 1 (370 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.46 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory