Align Histidinol-phosphate aminotransferase; EC 2.6.1.9; Imidazole acetol-phosphate transaminase (uncharacterized)
to candidate WP_012851688.1 TCUR_RS06510 Rv2231c family pyridoxal phosphate-dependent protein CobC
Query= curated2:A7HCR6 (364 letters) >NCBI__GCF_000024385.1:WP_012851688.1 Length = 345 Score = 95.9 bits (237), Expect = 1e-24 Identities = 113/348 (32%), Positives = 157/348 (45%), Gaps = 30/348 (8%) Query: 24 EREYGVSNVAKLASNENALGPSPLALAAAREACAKVHLYPDGSAYLLRNAIAAKLGVPPE 83 +RE G +A A N P A A + YPD R A+A + G E Sbjct: 18 DRELG-DGLADFAVNVRPGTPPAWLAEHIAAAMANLAAYPDPGR--ARRAVARRHGRRTE 74 Query: 84 EVMVGNGSNELIELLVRTFVLDGEEVLTSAQSFVAYKLAAHEHGRTLVEAPMKGRFHYDL 143 EV++ G+ E LL R V V+ Q F + A G + ++G F +D Sbjct: 75 EVLLTAGAAEAFVLLARA-VRPRRAVVVHPQ-FTEPEAALRAAGHRVERLLLEGDFTFD- 131 Query: 144 DALRKLLSRRTKLVFLANPDNPTGTWFTEAELTPFLDAVPKDTLVVLDEAYVEYVDAPGF 203 + LV + NP NPT A LT A P T+VV DEA+++ V PG Sbjct: 132 ---PARVPADADLVVIGNPTNPTSVLHPAAALTAL--ARPGRTVVV-DEAFMDCV--PGE 183 Query: 204 QDGLALRRKYPNVVVLRTFSKIYGLAGMRLGYGLARPEVVEYVDRVRPPFNTNLVAQAAG 263 + LA P VVVLR+ +K +GLAG+R GY LA P +++ + R +P + + A AA Sbjct: 184 PESLA-GAAVPGVVVLRSLTKTWGLAGLRAGYVLAEPPLIDALARAQPLWAVSTPALAAI 242 Query: 264 AA-----ALGDSAHVAKSRALVLEERPFLAKGLAALGAIVVP-SQGNFVLADFPGRTGKD 317 A AL ++ A+ A+ ER LA LA G VP ++ +F+ PG + Sbjct: 243 EACCRPHALAEAEEWARRLAV---ERDRLAGELARRGLTPVPGARASFLCVHTPG--AME 297 Query: 318 LFEALLREGVIAR---PVAGYGFPSALRITVGLRRENERCLAALGRIL 362 L E L R G R G G P LRI V R ++ L AL +L Sbjct: 298 LRERLRRRGFAVRRGDTFPGLG-PDWLRIAVRDRAADDALLKALDDLL 344 Lambda K H 0.320 0.138 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 330 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 364 Length of database: 345 Length adjustment: 29 Effective length of query: 335 Effective length of database: 316 Effective search space: 105860 Effective search space used: 105860 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory