Align Aspartate--tRNA(Asp/Asn) ligase; EC 6.1.1.23; Aspartyl-tRNA synthetase; AspRS; Non-discriminating aspartyl-tRNA synthetase; ND-AspRS (uncharacterized)
to candidate WP_012852474.1 TCUR_RS10510 aspartate--tRNA(Asn) ligase
Query= curated2:Q9Y9U7 (442 letters) >NCBI__GCF_000024385.1:WP_012852474.1 Length = 436 Score = 349 bits (896), Expect = e-101 Identities = 185/425 (43%), Positives = 265/425 (62%), Gaps = 9/425 (2%) Query: 22 VRVCGWAYRIRDLGRLKFILVRDRSGVIQATVKRGESPEDALRAAEDLKLESVVCVEGEL 81 V VCGW +R +++F+++RD +G++Q T KRG ++ +A E L ES V + G + Sbjct: 17 VTVCGWVNALRLQRKMQFVILRDPTGMVQITHKRGGEGDELEQAIEALTTESAVVITGRV 76 Query: 82 RQAPTRE--GVEVKVERLEVLSTPVEPLPLEVEGSEKASLPTRLKYRWLDIR-NPMVSAI 138 P + G+E+ ER+EV+ LP++ EK+ + RL +R+LDIR P + Sbjct: 77 VDNPIVKLGGLEIVPERVEVVGKAEASLPID----EKSGMEHRLDWRFLDIRLRPSSRLL 132 Query: 139 FELEAMVAKVFRDYYWSQGFVEIFTPKIVAAGTESGAEVFPVVYFDKTAFLAQSPQFYKQ 198 F+++ R+Y +++GF E+ TPK++ +ESGAEVF + YF A+LAQSPQFYKQ Sbjct: 133 FDVQTTFEAGLREYAYAEGFTEMHTPKLMGTASESGAEVFKLGYFGGDAYLAQSPQFYKQ 192 Query: 199 FAVIAGLERVFEIGPVFRAEPHHTSRHLNEYHSLDIEVGFIESYNDVMNYVEGFM-RAIV 257 AV AG+ERVFEIGPVFRAEP TSRH E+ +D+E+ +I+ DVM + E + AI Sbjct: 193 MAVAAGIERVFEIGPVFRAEPSFTSRHATEFTGVDVEMAWIDDVEDVMAFEERMLAHAIA 252 Query: 258 RMLEEDGRRVLELYGVELPRIPASGIPKIPLRKAYEILEEKYGKKVEYGEDLDSEGERLM 317 ++ + G + E YGV+L ++P P++ + +A EIL + EDLD EGER + Sbjct: 253 KVADVHGEAIREHYGVDL-KVPTVPFPRLTMAEAQEILRARGWDPAGEKEDLDPEGERAI 311 Query: 318 GAYAGEELDSDFVFIVEYPWKVRPFYTMRKDDEPSWTYSFDLLYRGLEIVTGGQREHRYH 377 A+ E+ +FVFI YP +RPFY MR D P T SFDLL++GLE+ TG QREHRY Sbjct: 312 SAHIAEQTGHEFVFITHYPASIRPFYHMRPKDRPDLTLSFDLLWKGLEVTTGAQREHRYD 371 Query: 378 RLLENLRDKGLDAESFQFYLDFFKHGAPPHGGAGMGLERIVMQTLKLENIREARMLPRDT 437 L + +KGLD Q Y++ F+ G PPHGG GMGL R+++ L L++IREA L R Sbjct: 372 VLCKQAAEKGLDTAPMQDYMNIFRFGTPPHGGLGMGLGRLLVAMLNLDSIREATFLFRGP 431 Query: 438 ERITP 442 R+TP Sbjct: 432 NRLTP 436 Lambda K H 0.321 0.140 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 508 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 442 Length of database: 436 Length adjustment: 32 Effective length of query: 410 Effective length of database: 404 Effective search space: 165640 Effective search space used: 165640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate WP_012852474.1 TCUR_RS10510 (aspartate--tRNA(Asn) ligase)
to HMM TIGR00458 (aspS: aspartate--tRNA(Asn) ligase (EC 6.1.1.23))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00458.hmm # target sequence database: /tmp/gapView.22873.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00458 [M=428] Accession: TIGR00458 Description: aspS_nondisc: aspartate--tRNA(Asn) ligase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-120 389.3 0.0 1.5e-120 389.0 0.0 1.0 1 lcl|NCBI__GCF_000024385.1:WP_012852474.1 TCUR_RS10510 aspartate--tRNA(Asn Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000024385.1:WP_012852474.1 TCUR_RS10510 aspartate--tRNA(Asn) ligase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 389.0 0.0 1.5e-120 1.5e-120 7 428 .] 10 436 .] 5 436 .] 0.94 Alignments for each domain: == domain 1 score: 389.0 bits; conditional E-value: 1.5e-120 TIGR00458 7 keekdgkevllrgwvheirdlGalifvllrdregliqilvkkkkvskelfklikklkkesvvavkGkvk 75 ++ d + v++ gwv +r + ++ fv+lrd g++qi+ k+ ++el + i+ l +es v+++G+v lcl|NCBI__GCF_000024385.1:WP_012852474.1 10 RDHLD-QTVTVCGWVNALRLQRKMQFVILRDPTGMVQITHKRGGEGDELEQAIEALTTESAVVITGRVV 77 44444.78***********************************************************99 PP TIGR00458 76 eke.kapqgleiipeklevlneakeplPldleekveaeldtrldarfldlr.rpkvqaifkirsevles 142 + +glei+pe++ev+ +a+++lP+d k + ++ rld rfld+r rp+ + +f +++ lcl|NCBI__GCF_000024385.1:WP_012852474.1 78 DNPiVKLGGLEIVPERVEVVGKAEASLPIDE--K--SGMEHRLDWRFLDIRlRPSSRLLFDVQTTFEAG 142 77615689*********************85..4..46789**********8899************** PP TIGR00458 143 vreflaeegfievntPklvasateGGtelfeityfereaflaqsPqlykqvllaaglervyeiaPifra 211 +re+ + egf+e++tPkl+++a+e G+e+f++ yf ++a+laqsPq+ykq+ +aag+erv+ei+P+fra lcl|NCBI__GCF_000024385.1:WP_012852474.1 143 LREYAYAEGFTEMHTPKLMGTASESGAEVFKLGYFGGDAYLAQSPQFYKQMAVAAGIERVFEIGPVFRA 211 ********************************************************************* PP TIGR00458 212 eehntkrhlnevisidiemafedh.kdvldileelvvrvfedvaeklkkel.evlevklevpeeklerl 278 e + t rh +e++++d+ema+ d+ +dv+ e+++ +++ +va+ +++ e +v+l+vp +++rl lcl|NCBI__GCF_000024385.1:WP_012852474.1 212 EPSFTSRHATEFTGVDVEMAWIDDvEDVMAFEERMLAHAIAKVADVHGEAIrEHYGVDLKVPTVPFPRL 280 ************************9******************998777653789************** PP TIGR00458 279 tydeaieilrakG.keikdgedlsteaekllG....ekmdgly.fitdfPteikPfytmPdednPeisk 341 t ea eilra+G + ++ edl e e+++ e+ + ++ fit +P+ i+Pfy m ++d+P+ + lcl|NCBI__GCF_000024385.1:WP_012852474.1 281 TMAEAQEILRARGwDPAGEKEDLDPEGERAISahiaEQTGHEFvFITHYPASIRPFYHMRPKDRPDLTL 349 *************446899***********998887666665559************************ PP TIGR00458 342 sfdllyrdleissGaqrihdydllvekikakGlePeslksyleafkyGmPPhaGwGlGaerlvmvlldl 410 sfdll+++le+++Gaqr h yd+l + +kGl+ +++y++ f++G PPh G G+G+ rl +++l+l lcl|NCBI__GCF_000024385.1:WP_012852474.1 350 SFDLLWKGLEVTTGAQREHRYDVLCKQAAEKGLDTAPMQDYMNIFRFGTPPHGGLGMGLGRLLVAMLNL 418 ********************************************************************* PP TIGR00458 411 knireavlfPrdrkrltP 428 + irea+++ r ++rltP lcl|NCBI__GCF_000024385.1:WP_012852474.1 419 DSIREATFLFRGPNRLTP 436 ****************99 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (428 nodes) Target sequences: 1 (436 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.90 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory