Align Argininosuccinate synthase; Citrulline--aspartate ligase; EC 6.3.4.5 (characterized)
to candidate WP_012852507.1 TCUR_RS10670 argininosuccinate synthase
Query= SwissProt::P59846 (400 letters) >NCBI__GCF_000024385.1:WP_012852507.1 Length = 400 Score = 327 bits (837), Expect = 5e-94 Identities = 169/399 (42%), Positives = 254/399 (63%), Gaps = 3/399 (0%) Query: 2 KIVLAYSGGLDTSIILKWLKETYRAEVIAFTADIGQG-EEVEEAREKALRTGASKAIALD 60 ++VLAYSGGLDTS+ + +L E EVIA D+GQG E++E R++AL GA +A+ +D Sbjct: 4 RVVLAYSGGLDTSVAIPYLAEQTGGEVIAVAVDVGQGGEDLEVIRKRALACGAVEAVVVD 63 Query: 61 LKEEFVRDFVFPMMRAGAVYEGYYLLGTSIARPLIAKHLVRIAEEEGAEAIAHGATGKGN 120 +EEF DF P ++A A+Y Y L ++++RPLI KHL A+E G A+AHG TGKGN Sbjct: 64 AREEFASDFCVPALQANALYMDRYPLVSALSRPLIVKHLAAAAKEFGGTAVAHGCTGKGN 123 Query: 121 DQVRFELTAYALKPDIKVIAPWREWSFQGRKEMIAYAEAHGIPVPVTQEKPYSMDANLLH 180 DQVRFE AL PD+KVIAP R++++ R + I YAE+ G+P+ V+ + PYS+D NL Sbjct: 124 DQVRFEAGLAALNPDLKVIAPARDFAWT-RDKAIEYAESKGLPIDVSAKSPYSIDQNLWG 182 Query: 181 ISYEGGVLEDPWAEPPKGMFRMTQDPEEAPDAPEYVEVEFFEGDPVAVNGERLSPAALLQ 240 + E G LED W P + ++ T DP D P+ V + F G PVA++G L+P +++ Sbjct: 183 RAVETGFLEDIWNAPIEDLYDYTSDPSAQRD-PDEVVITFRAGVPVALDGRELTPLQIIE 241 Query: 241 RLNEIGGRHGVGRVDIVENRFVGMKSRGVYETPGGTILYHARRAVESLTLDREVLHQRDM 300 LN+ G GVGR+D+VE+R VG+KSR VYE P L A +E++T++R++ + Sbjct: 242 ELNQRAGAQGVGRIDMVEDRLVGIKSREVYEAPAAIALITAHMELENVTVERDLARFKRS 301 Query: 301 LSPKYAELVYYGFWYAPEREALQAYFDHVARSVTGVARLKLYKGNVYVVGRKAPKSLYRQ 360 + ++ ELVY G WY+P + +L A+ + V+G R+ L+ G V GR++ SLY Sbjct: 302 VDQRWGELVYDGLWYSPLKRSLDAFIAESQKHVSGEIRMTLHGGRAVVTGRRSDASLYDH 361 Query: 361 DLVSFDEAGGYDQKDAEGFIKIQALRLRVRALVEREGHG 399 DL ++D +DQ A+GF+++ +L ++ A+ +R G Sbjct: 362 DLATYDTGDTFDQSLAKGFVELWSLPSKIAAVRDRRVQG 400 Lambda K H 0.319 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 418 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 400 Length adjustment: 31 Effective length of query: 369 Effective length of database: 369 Effective search space: 136161 Effective search space used: 136161 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_012852507.1 TCUR_RS10670 (argininosuccinate synthase)
to HMM TIGR00032 (argG: argininosuccinate synthase (EC 6.3.4.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00032.hmm # target sequence database: /tmp/gapView.26565.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00032 [M=394] Accession: TIGR00032 Description: argG: argininosuccinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-155 504.0 0.0 2.2e-155 503.8 0.0 1.0 1 lcl|NCBI__GCF_000024385.1:WP_012852507.1 TCUR_RS10670 argininosuccinate s Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000024385.1:WP_012852507.1 TCUR_RS10670 argininosuccinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 503.8 0.0 2.2e-155 2.2e-155 1 389 [. 4 391 .. 4 396 .. 0.99 Alignments for each domain: == domain 1 score: 503.8 bits; conditional E-value: 2.2e-155 TIGR00032 1 kvvlaysGGlDtsvalklleek.gaeviavtvdvGqpeedldaieekalklGaekayviDareefvkdy 68 +vvlaysGGlDtsva+++l e+ g eviav+vdvGq+ edl+ i+++al++Ga++a+v+Dareef++d+ lcl|NCBI__GCF_000024385.1:WP_012852507.1 4 RVVLAYSGGLDTSVAIPYLAEQtGGEVIAVAVDVGQGGEDLEVIRKRALACGAVEAVVVDAREEFASDF 72 69********************999******************************************** PP TIGR00032 69 lfaaiqanavyegkYllstaLaRpliakklvevakkegaeavahGctgKGnDqvRFelsilllnpdlkv 137 ++a+qana+y ++Y+l++aL+Rpli k l ++ak+ g +avahGctgKGnDqvRFe+ + +lnpdlkv lcl|NCBI__GCF_000024385.1:WP_012852507.1 73 CVPALQANALYMDRYPLVSALSRPLIVKHLAAAAKEFGGTAVAHGCTGKGNDQVRFEAGLAALNPDLKV 141 ********************************************************************* PP TIGR00032 138 iaPvreleliReeeieyaaekGievpvekekaysiDenllgrsiEageLEdpsteppediyelvkdpie 206 iaP+r+ ++R + ieya++kG+++ v+ +++ysiD+nl+gr++E+g LEd + +p+ed y+++ dp + lcl|NCBI__GCF_000024385.1:WP_012852507.1 142 IAPARDFAWTRDKAIEYAESKGLPIDVSAKSPYSIDQNLWGRAVETGFLEDIWNAPIEDLYDYTSDPSA 210 *****************************************************************9988 PP TIGR00032 207 ktedepevveieFekGvPvalngeslepvelilkaneiagkhGvGriDivEdRiiglKsReiYEapall 275 + +p++v i+F+ GvPval+g++l+p+++i+++n+ ag++GvGriD+vEdR++g+KsRe+YEapa++ lcl|NCBI__GCF_000024385.1:WP_012852507.1 211 QR--DPDEVVITFRAGVPVALDGRELTPLQIIEELNQRAGAQGVGRIDMVEDRLVGIKSREVYEAPAAI 277 87..99*************************************************************** PP TIGR00032 276 lLikAhkdLetlvltkdvlefkeiveekyseliYkGlwfdplaealdalikktqervtGtvrvklfkGn 344 Li+Ah +Le+ + ++d ++fk+ v+++++el+Y Glw++pl+ lda+i ++q++v+G++r+ l+ G lcl|NCBI__GCF_000024385.1:WP_012852507.1 278 ALITAHMELENVTVERDLARFKRSVDQRWGELVYDGLWYSPLKRSLDAFIAESQKHVSGEIRMTLHGGR 346 ********************************************************************* PP TIGR00032 345 aivigrkseyslYdeelvsfekdkefdqkdaiGfikirglqikvy 389 a+v gr+s+ slYd++l++++ ++fdq+ a+Gf+++++l+ k+ lcl|NCBI__GCF_000024385.1:WP_012852507.1 347 AVVTGRRSDASLYDHDLATYDTGDTFDQSLAKGFVELWSLPSKIA 391 ****************************************98875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (394 nodes) Target sequences: 1 (400 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 7.10 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory