Align 2-aminoadipate transaminase (EC 2.6.1.39) (characterized)
to candidate WP_012852598.1 TCUR_RS11130 PLP-dependent aminotransferase family protein
Query= BRENDA::Q72LL6 (397 letters) >NCBI__GCF_000024385.1:WP_012852598.1 Length = 486 Score = 152 bits (385), Expect = 2e-41 Identities = 119/353 (33%), Positives = 178/353 (50%), Gaps = 14/353 (3%) Query: 42 PAPELFPKEEAAEAAARILREKGEVALQYSPTEGYAPLRAFVAE-----WIGVRPEEVLI 96 PA E AAEA A + R Y PT G A LR +A RP+++++ Sbjct: 126 PAAPSCLAEAAAEAMAELPRHS--TGHGYEPT-GLAVLREAIAARYTELGAPTRPDQIVV 182 Query: 97 TTGSQQALDLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQGPRFLTVPAGEEGPDLDALEE 156 TTG+QQA+ L+ V + G VL+E P+Y A++A R G R + V G EG DL+ + Sbjct: 183 TTGAQQAISLLAHVLVTPGDAVLIERPTYPHALEALRRCGGRLVPVGVG-EGWDLELVAA 241 Query: 157 VLKRERPRFLYLIPSFQNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYRELYFGEARLP 216 +++ R YLIP FQNPTG L R L+ +++ D+++ EL A Sbjct: 242 SMRQAAARLAYLIPDFQNPTGHLLDDAGRAALVAAARSADALLIVDESFSELSLDPAAPR 301 Query: 217 SLFELAREAGYPGVIYLGSFSKVLSPGLRVAFAVAHPEALQKLVQAKQGADLHTPMLNQM 276 A + G VI +GS SK++ GLR+ + A +++L+ A+ DL +P+L Q+ Sbjct: 302 PRPVAAHDTG-GRVISIGSASKLMWGGLRIGWIRAGAPLVRRLIAARASVDLASPVLEQL 360 Query: 277 LVHELLKEGFSERLERVRRVYREKAQAMLHALDREVPKEVRYTRPKGGMFVWMELPKGLS 336 + LL+ R ER + + R + A+ AL RE+ E +T P+GGM +W+ L + Sbjct: 361 VAWRLLERIEQVRAERAQELTRSR-DALAGAL-RELLPEWEFTLPRGGMSLWVRLEAPV- 417 Query: 337 AEGLFRRALEENVAFVPGGPFFANGGGENTLRLSYATLDREGIAEGVRRLGRA 389 A + RA V VPG F +G E+ LRL Y L + + V RL A Sbjct: 418 ATPVAERAWRHGVRVVPGPVFGVDGVLEDCLRLPY-VLPPQTLRTAVERLAGA 469 Score = 25.8 bits (55), Expect = 0.003 Identities = 16/52 (30%), Positives = 18/52 (34%) Query: 35 LSFAGGLPAPELFPKEEAAEAAARILREKGEVALQYSPTEGYAPLRAFVAEW 86 L +GGLP P E AA + R A EGY R W Sbjct: 35 LVLSGGLPPRMRLPAERDLAAALGVSRTTVTAAYDRLRAEGYVESRQGAGSW 86 Lambda K H 0.320 0.139 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 523 Number of extensions: 33 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 397 Length of database: 486 Length adjustment: 32 Effective length of query: 365 Effective length of database: 454 Effective search space: 165710 Effective search space used: 165710 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory