Align Methionine synthase component, methyltransferase domain (EC:2.1.1.13) (characterized)
to candidate WP_012852642.1 TCUR_RS11345 methionine synthase
Query= reanno::Phaeo:GFF1321 (338 letters) >NCBI__GCF_000024385.1:WP_012852642.1 Length = 1157 Score = 112 bits (281), Expect = 4e-29 Identities = 93/309 (30%), Positives = 138/309 (44%), Gaps = 28/309 (9%) Query: 15 LLADGATGTNLFNMGLQSGD------APELWNVDEPKKITALYQGAVDAGSDLFLTNTFG 68 ++ADGA GT L D E+ NV P + A++ +DAG D TNTFG Sbjct: 17 VVADGAMGTMLQAHNPTLDDFQGYEGCNEILNVTRPDIVRAVHAAYLDAGVDCVETNTFG 76 Query: 69 GTAARLKLHDAHRRVRELNVAGAELGRNVAD---RSERKIAVAGSVGPTGEIMQPVGELS 125 L + R+ EL AGA + R VAD ER V GS+GP G + +G +S Sbjct: 77 ANLGNLGEYGITDRIEELAEAGARIAREVADSYSTPERPRWVIGSIGP-GTKLPTLGHVS 135 Query: 126 HALAVEMFHEQAEALKEGGVDVLWLETISAPEEYRAAAEAFKL------ADMPWCGTMSF 179 + E + A L GG L +ET + +AA K AD+ ++ Sbjct: 136 YGELRESYRRTAAGLIAGGAHALLVETCQDLLQVKAALNGAKQAVAEAGADVVLIAQVTI 195 Query: 180 DTAGRTMMGVTSADMAQLVEEFDPAPL-AFGANCGTGASDILRTVLGFAAQGTTRPIISK 238 + G ++G +++ + +P + G NC TG ++ + L + ++ + Sbjct: 196 EQNGAMLLG---SEIGAALTALEPLGIDLIGLNCATGPAE-MSEHLRYLSRHARVGLSCM 251 Query: 239 GNAGIPKYVDGHIHYDGTP-TLMGEYAAMARDCGAKIIGGCCGTMPDHLRAM------RE 291 NAG+P+ Y TP L + A RD G ++GGCCGT P+HLR + RE Sbjct: 252 PNAGLPELTPDGARYPLTPQELADAHDAFTRDYGLSLVGGCCGTTPEHLRLVVERVRGRE 311 Query: 292 ALDTRPRGE 300 RPR E Sbjct: 312 LAPRRPRPE 320 Lambda K H 0.317 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 953 Number of extensions: 55 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 1157 Length adjustment: 37 Effective length of query: 301 Effective length of database: 1120 Effective search space: 337120 Effective search space used: 337120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory