Align Histidinol-phosphate aminotransferase; EC 2.6.1.9; Imidazole acetol-phosphate transaminase (uncharacterized)
to candidate WP_012853225.1 TCUR_RS27540 histidinol-phosphate transaminase
Query= curated2:Q2J8K9 (397 letters) >NCBI__GCF_000024385.1:WP_012853225.1 Length = 366 Score = 446 bits (1146), Expect = e-130 Identities = 234/360 (65%), Positives = 267/360 (74%), Gaps = 5/360 (1%) Query: 23 LPLRDSLRGLSPYGAPQLDVPVRLNTNENPHPPSVGLVDAIGKAAALAATEANRYPDRDA 82 LPLR+ LRG PYGAPQLDVPVRLNTNENP+PPS LV+A+ KA A AA NRYPDRDA Sbjct: 7 LPLREDLRGREPYGAPQLDVPVRLNTNENPYPPSERLVEALAKAVAAAAASLNRYPDRDA 66 Query: 83 EALRADLAYYLTPDA-GFGVHTSQVWAANGSNEILQQLLQAFGGPGRVALGFEPSYSMHR 141 ALRA+LA +L D G + +VWAANGSNEI+QQ+LQAFGGPGR ALGFEPSYSMH Sbjct: 67 LALRAELADFLNHDTPGAELTAERVWAANGSNEIIQQILQAFGGPGRCALGFEPSYSMHP 126 Query: 142 LIALATATEWVAGQRAEDFTLSPAVVTDAIARHRPALVFLCSPNNPTGTALPPEVVAAAC 201 +I T T W+ R EDF L AI HRP +VFL SPNNPTGT+LP EV+ Sbjct: 127 IITHVTGTRWINAHRDEDFGLDVDRALAAIDEHRPDVVFLTSPNNPTGTSLPLEVI---- 182 Query: 202 EAVEATGSGMVVVDEAYAEFRRAGVPSTLTLLPRHPRLVVTRTMSKAFALAGARVGYLAA 261 EA+ A GMVVVDEAYAEFRR S L LL HPRL+VTRTMSKAFA+AG R+GYLAA Sbjct: 183 EAIAAAAPGMVVVDEAYAEFRREDTLSALELLAEHPRLIVTRTMSKAFAMAGVRLGYLAA 242 Query: 262 HPAVVDSLYLVRLPYHLSSFTQAVARTALAHADELLGTVEAVKAQRDRIVRELPALGLRL 321 HPAV+++L LVRLPYHLSS TQA ARTALAHADELLG+V ++ +RD IV L GLR+ Sbjct: 243 HPAVIEALLLVRLPYHLSSITQAAARTALAHADELLGSVAQLRTERDLIVGWLRGQGLRV 302 Query: 322 APSDANFVFFGRFADQRAVWQSLLDAGVLVRDVGLTGWLRVTAGLPNEVDAFLGALGRTL 381 A SDANFV FG F D+R VWQ++LD GVL+R+VG WLRVT G P E+ AF AL L Sbjct: 303 ADSDANFVLFGTFPDRRRVWQAMLDQGVLIREVGPPQWLRVTVGTPAEMAAFRSALTTAL 362 Lambda K H 0.320 0.135 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 466 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 366 Length adjustment: 30 Effective length of query: 367 Effective length of database: 336 Effective search space: 123312 Effective search space used: 123312 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate WP_012853225.1 TCUR_RS27540 (histidinol-phosphate transaminase)
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.677513.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.1e-100 320.7 0.0 6e-100 320.4 0.0 1.0 1 NCBI__GCF_000024385.1:WP_012853225.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000024385.1:WP_012853225.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 320.4 0.0 6e-100 6e-100 1 346 [. 10 358 .. 10 361 .. 0.95 Alignments for each domain: == domain 1 score: 320.4 bits; conditional E-value: 6e-100 TIGR01141 1 rekikklepYqpgarelgekevvkLnsnEnPfgpsekvkealkeelk....klhrYpdpqalelkealakylg 69 re+++ epY ++ + v+Ln+nEnP++pse+++eal ++++ +l+rYpd++al+l+++la++l+ NCBI__GCF_000024385.1:WP_012853225.1 10 REDLRGREPYGAP----QLDVPVRLNTNENPYPPSERLVEALAKAVAaaaaSLNRYPDRDALALRAELADFLN 78 6788888899885....45579*******************9999988888********************** PP TIGR01141 70 .......veeenillgnGsdelielliraflepgdavlvleptysmYevsakiagaevkevplkedgqedlea 135 +++e ++++nGs+e+i+ +++af pg+ +l +ep+ysm++++++++g+++++++ +ed+ d++ NCBI__GCF_000024385.1:WP_012853225.1 79 hdtpgaeLTAERVWAANGSNEIIQQILQAFGGPGRCALGFEPSYSMHPIITHVTGTRWINAHRDEDFGLDVDR 151 ******************************************************************7777777 PP TIGR01141 136 vle.aakekvklvflasPnnPtGnllkreeiekvleevedalVVvDeAYieFsee..asvlellaeypnlvvl 205 +l+ + ++++++vfl+sPnnPtG++l e ie++++++ ++VVvDeAY eF +e s+lellae+p l+v+ NCBI__GCF_000024385.1:WP_012853225.1 152 ALAaIDEHRPDVVFLTSPNNPTGTSLPLEVIEAIAAAA-PGMVVVDEAYAEFRREdtLSALELLAEHPRLIVT 223 766477899****************************8.9*************998899************** PP TIGR01141 206 rTlSKafgLAglRvGyaianaeiiealekvrapynvsslaleaavaalrdsdkiektveevkkererlleelk 278 rT+SKaf++Ag+R+Gy+ a++++ieal vr py++ss++++aa +al ++d++ +v++++ er+ + l+ NCBI__GCF_000024385.1:WP_012853225.1 224 RTMSKAFAMAGVRLGYLAAHPAVIEALLLVRLPYHLSSITQAAARTALAHADELLGSVAQLRTERDLIVGWLR 296 ************************************************************************9 PP TIGR01141 279 kleglevyeSkaNFvlikvkedaeelleallekgiivRdlksaeglleeclRitvGtreenerlleal 346 gl+v +S+aNFvl+ + d +++++a+l++g+++R+++ + +++lR+tvGt+ e+ ++ al NCBI__GCF_000024385.1:WP_012853225.1 297 GQ-GLRVADSDANFVLFGTFPDRRRVWQAMLDQGVLIREVG--P---PQWLRVTVGTPAEMAAFRSAL 358 87.8*************9999*******************8..3...78************9997776 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (366 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 24.68 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory