Align Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 (uncharacterized)
to candidate WP_012964651.1 FERP_RS00575 aspartate carbamoyltransferase
Query= curated2:O29013 (307 letters) >NCBI__GCF_000025505.1:WP_012964651.1 Length = 298 Score = 131 bits (330), Expect = 2e-35 Identities = 102/306 (33%), Positives = 163/306 (53%), Gaps = 18/306 (5%) Query: 1 MKHLLSMADLEKDELFEILKLAEKLKEERYKGVVTDYLKNKSLAMIFELPSTRTRVSFEV 60 MKHL+S+ DL K ++ IL LAE L + ++ K LA +F PSTRTR+SFEV Sbjct: 1 MKHLISIEDLSKSDIERILNLAEYLIPVAEGKKRMEIMRGKILANLFFEPSTRTRMSFEV 60 Query: 61 AMTDLGGHALYLGWDEL-QLGRGEPIKDTARVLSRYVHAVMMRVREHSTIEEFARYSTVP 119 AM LGG + L E + +GE + DT RV+S Y +++R + A S+VP Sbjct: 61 AMKRLGGEVVNLTSQEASSIAKGENLADTIRVISGYADVIVIRHSLEGAAKFAAENSSVP 120 Query: 120 VIN-GLSNLEHPCQVIADLLTIYEYRGDFKDVTLAWVGD--GNNVCNSMILAAALTGMKM 176 VIN G +HP Q + DL T+ ++V +A VGD + +S++ A L K+ Sbjct: 121 VINAGDGAGQHPTQTLLDLFTL-RREAKLENVKIALVGDLKYSRTVHSLVKALKLYNAKI 179 Query: 177 VISTPENYDPNPEIVKKAEEMGAKLRFVRDPKEAVKEADVIYTDVWTSMGQE--AEKEAR 234 P+ E+V EE+G + + D + E D IY T + +E ++E Sbjct: 180 YYVCPDTLMLPEELV---EEVGGERVALED---IISEVDAIYV---TRIQKERFPDEEEY 230 Query: 235 LKAFQPYQVSDELLKFSKDDVVVMHCLPAHRGEEITDEVMEGKHSIVFDQAENRLHAQKA 294 K Y ++ ++L+ +K+D+++MH LP R +EIT +V + KH++ + QA + + A Sbjct: 231 RKVAGSYVITSKILENAKEDLIIMHPLP--RVDEITFDVDKTKHAVYYKQAFYGVPVRMA 288 Query: 295 ILLKLL 300 IL +++ Sbjct: 289 ILCEVV 294 Lambda K H 0.318 0.134 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 203 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 298 Length adjustment: 27 Effective length of query: 280 Effective length of database: 271 Effective search space: 75880 Effective search space used: 75880 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory