Align Histidine biosynthesis bifunctional protein HisB; EC 3.1.3.15; EC 4.2.1.19 (characterized)
to candidate WP_012965612.1 FERP_RS05525 imidazoleglycerol-phosphate dehydratase HisB
Query= SwissProt::Q8ABA7 (374 letters) >NCBI__GCF_000025505.1:WP_012965612.1 Length = 186 Score = 152 bits (385), Expect = 5e-42 Identities = 86/191 (45%), Positives = 120/191 (62%), Gaps = 8/191 (4%) Query: 185 KAEVRRTTKETDIYVSLNLDGNGGCDISTGLGFFDHMLEQIGKHSGMDLTIRVKGDLEVD 244 KA+V R TKET + V ++ G +ISTG+ F DHMLE KH+ ++L ++ KGDLEVD Sbjct: 2 KAKVSRETKETKVEVYVDFSGEN-YEISTGIPFLDHMLENFAKHAEIELVVKAKGDLEVD 60 Query: 245 EHHTIEDTAIALGECIYQALGSKRGIERYGYAL-PMDDCLCQVCLDFGGRPWLVWDAEFN 303 EHHTIED AI LG+ +ALGS+ G++R+GYA+ PMD+ + +D GR V + EF Sbjct: 61 EHHTIEDVAITLGKAFREALGSREGLKRFGYAIVPMDESVAICGIDLSGRGVFVLNGEFG 120 Query: 304 REKIGEMPTEMFLHFFKSLSDAAKMNLNIKAEGQNEHHKIEGIFKALARALKMALKRDIY 363 I E +HFF + + +N+ ++ G N HHKIE FKALA ++KMA ++ Sbjct: 121 DAGI---RGENVIHFFDTFCRNSGINVFLEVRGVNSHHKIEASFKALALSIKMATEKG-- 175 Query: 364 HFELPSSKGVL 374 L S+KGVL Sbjct: 176 -KGLKSTKGVL 185 Lambda K H 0.321 0.140 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 197 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 374 Length of database: 186 Length adjustment: 25 Effective length of query: 349 Effective length of database: 161 Effective search space: 56189 Effective search space used: 56189 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory