Align phosphoserine aminotransferase monomer (EC 2.6.1.1; EC 2.6.1.52) (characterized)
to candidate WP_012966670.1 FERP_RS11050 alanine--glyoxylate aminotransferase family protein
Query= metacyc::MONOMER-15919 (385 letters) >NCBI__GCF_000025505.1:WP_012966670.1 Length = 374 Score = 323 bits (828), Expect = 5e-93 Identities = 171/368 (46%), Positives = 244/368 (66%), Gaps = 11/368 (2%) Query: 7 KKLLMIPGPTMVPPEVLNAMALPVIGHRTKDYSNLLEDTIEKLKKVFITENDTFLITGSG 66 + LLMIPGP + ++ A+ +I HR+KD+ + E E LK +F T+ D +I+GSG Sbjct: 4 ENLLMIPGPVQLHERIIKALGSQMISHRSKDFEEVYEYCREALKPLFGTKGDVVIISGSG 63 Query: 67 TAAMDMAISNIIKRGDKVLNIVTGNFGERFANIVKAYKGEAIRLDVEWGDMAEPEAVKEI 126 TA M+ A+++ K K+ + G FGERFA I Y E + EWGD + + V+E Sbjct: 64 TAGMEAAVASFSKVR-KITCVSNGKFGERFAEIAWRY-AEVDHVKFEWGDSIDLDKVRES 121 Query: 127 LDKYDDIKAVTVVHNETSTGARNPIKEIGEVVKDYDALYIVDTVSSLGGDYVNVDKFHID 186 L+ ++ VT VHNETSTG NP +EI ++ K+YDAL ++D ++S+GGD V +D++ +D Sbjct: 122 LENGSEM--VTFVHNETSTGILNPAREICKIAKEYDALVVMDGITSVGGDEVRMDEWGVD 179 Query: 187 ICVTGSQKCLAAPPGLAAITVSEKAWEVIKKNDDKVGFYLDLLAYKKYYEEKKQTPYTPS 246 +C+ GSQKCL APPGLAA+ ++EKAWE +++V +YLDL AY K EK QTPYTP+ Sbjct: 180 VCIVGSQKCLGAPPGLAAVAINEKAWEFY---NERVPYYLDLKAYVK-KAEKNQTPYTPA 235 Query: 247 VNLTYALNVALDLVLEEGIENRVKRHERLAKATRAGLEAMGIELFAK---ERARSVTVTS 303 V L AL AL ++ EEG+ENR++RH RLAKA R G+ELF + + S TVT+ Sbjct: 236 VPLFLALKEALKIIEEEGLENRIERHRRLAKAVREWAIEAGLELFPRLNEYSSYSNTVTA 295 Query: 304 AKYPEGIEDSKFRGILSNKYNIVVAGGQKHLAGKIFRIGHMGICGEKEVLATLACVELAL 363 K P+GI DS+ RG L N++ I ++GGQ+HL GKIFRIG+MG ++E++ATLA +E + Sbjct: 296 IKMPKGITDSELRGTLRNEFGITISGGQEHLKGKIFRIGNMGNVSKREIVATLAAIESVM 355 Query: 364 KELGFEVK 371 G E+K Sbjct: 356 LRKGVEIK 363 Lambda K H 0.316 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 397 Number of extensions: 20 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 374 Length adjustment: 30 Effective length of query: 355 Effective length of database: 344 Effective search space: 122120 Effective search space used: 122120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory