Align acetylglutamate kinase (EC 2.7.2.8) (characterized)
to candidate WP_012966700.1 FERP_RS11200 acetylglutamate kinase
Query= BRENDA::Q9X2A4 (282 letters) >NCBI__GCF_000025505.1:WP_012966700.1 Length = 290 Score = 294 bits (753), Expect = 1e-84 Identities = 151/288 (52%), Positives = 212/288 (73%), Gaps = 13/288 (4%) Query: 3 IDTVNVLLEALPYIKEFYGKTFVIKFGGSAMKQENAKKAFIQDIILLKYTGIKPIIVHGG 62 ++ V L+EALPYI+EF+GK VIK GG AM E ++ ++D+ILL + GIKPI+VHGG Sbjct: 1 MEKVKTLVEALPYIREFHGKVMVIKIGGHAMVNEKILESAVRDVILLYFVGIKPIVVHGG 60 Query: 63 GPAISQMMKDLGIEPVFKNGHRVTDEKTMEIVEMVLVGKINKEIVMNLNLHGGRAVGICG 122 GP IS+ M+ LGI+P F +G RVTDE+T+E+V+MVL GKIN +IV +GG+AVG+ G Sbjct: 61 GPEISEKMERLGIKPKFVDGLRVTDEETIEVVQMVLDGKINSKIVSLFIKNGGKAVGMSG 120 Query: 123 KDSKLIVAEK---ETKHG------DIGYVGKVKKVNPEILHALIENDYIPVIAPVGIGED 173 KD L+VA+K + K G D+GYVG+ + VNPEIL LI+N +IPV++PV + + Sbjct: 121 KDGLLVVAKKKKVKKKIGDSEVELDLGYVGETEIVNPEILKILIDNGFIPVVSPVAVDLN 180 Query: 174 GHSYNINADTAAAEIAKSLMAEKLILLTDVDGVLKD----GKLISTLTPDEAEELIRDGT 229 G+ YN+NADT A +IA +L A+KLI+LTDV G+L+D +IS ++ E EE+++ G Sbjct: 181 GNIYNMNADTVAGDIAAALKAKKLIILTDVPGILRDVNDPNSVISKISLKELEEMLKKGE 240 Query: 230 VTGGMIPKVECAVSAVRGGVGAVHIINGGLEHAILLEIFSRKGIGTMI 277 ++GGMIPK E + A++GGV HIING +EHAILLE+F+++GIGTM+ Sbjct: 241 LSGGMIPKAEAIIKALKGGVERGHIINGSVEHAILLELFTKEGIGTMV 288 Lambda K H 0.318 0.140 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 328 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 282 Length of database: 290 Length adjustment: 26 Effective length of query: 256 Effective length of database: 264 Effective search space: 67584 Effective search space used: 67584 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
Align candidate WP_012966700.1 FERP_RS11200 (acetylglutamate kinase)
to HMM TIGR00761 (argB: acetylglutamate kinase (EC 2.7.2.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00761.hmm # target sequence database: /tmp/gapView.26125.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00761 [M=231] Accession: TIGR00761 Description: argB: acetylglutamate kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-85 271.5 8.7 3.3e-85 271.3 8.7 1.1 1 lcl|NCBI__GCF_000025505.1:WP_012966700.1 FERP_RS11200 acetylglutamate kin Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000025505.1:WP_012966700.1 FERP_RS11200 acetylglutamate kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 271.3 8.7 3.3e-85 3.3e-85 1 231 [] 21 265 .. 21 265 .. 0.97 Alignments for each domain: == domain 1 score: 271.3 bits; conditional E-value: 3.3e-85 TIGR00761 1 tiViKiGGaais..elleelakdiaklrkegiklvivHGGgpeinelleklgievefvnglRvTdketl 67 ++ViKiGG+a+ ++le+ ++d++ l+ +gik+++vHGGgpei+e +e+lgi+++fv+glRvTd+et+ lcl|NCBI__GCF_000025505.1:WP_012966700.1 21 VMVIKIGGHAMVneKILESAVRDVILLYFVGIKPIVVHGGGPEISEKMERLGIKPKFVDGLRVTDEETI 89 58*********98899***************************************************** PP TIGR00761 68 evvemvligkvnkelvallekhgikavGltgkDgqlltaekldke..........dlgyvGeikkvnke 126 evv+mvl gk+n+++v l+ k+g kavG++gkDg l++a+k +++ dlgyvGe++ vn+e lcl|NCBI__GCF_000025505.1:WP_012966700.1 90 EVVQMVLDGKINSKIVSLFIKNGGKAVGMSGKDGLLVVAKKKKVKkkigdsevelDLGYVGETEIVNPE 158 ****************************************55555569********************* PP TIGR00761 127 lleallkagiipviaslaldeegqllNvnaDtaAaelAaaleAekLvlLtdvaGileg..dkkslisel 193 +l+ l+++g+ipv++++a+d +g+++N+naDt+A+++Aaal+A+kL++Ltdv+Gil++ d +s+is++ lcl|NCBI__GCF_000025505.1:WP_012966700.1 159 ILKILIDNGFIPVVSPVAVDLNGNIYNMNADTVAGDIAAALKAKKLIILTDVPGILRDvnDPNSVISKI 227 *********************************************************999********* PP TIGR00761 194 eleeieqlikqavikgGmipKveaalealesgvkkvvi 231 +l+e+e+++k++ + gGmipK ea+++al++gv++ +i lcl|NCBI__GCF_000025505.1:WP_012966700.1 228 SLKELEEMLKKGELSGGMIPKAEAIIKALKGGVERGHI 265 **********************************9887 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (231 nodes) Target sequences: 1 (290 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 8.85 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory