Align LL-diaminopimelate aminotransferase (EC 2.6.1.83) (characterized)
to candidate WP_012968383.1 KVAR_RS14595 diaminopimelate aminotransferase
Query= BRENDA::O66630 (387 letters) >NCBI__GCF_000025465.1:WP_012968383.1 Length = 391 Score = 304 bits (779), Expect = 2e-87 Identities = 155/387 (40%), Positives = 230/387 (59%), Gaps = 1/387 (0%) Query: 2 FEFSDRLKVLPPYLFAELDRKKQEKIEQGVDVIDLGVGDPDMPTPKPIVEAAKKALENPE 61 F S + L LF+ L++ E + + +IDL G PD PTP ++++ + A+ E Sbjct: 4 FTASPLVDALEENLFSLLEKLAAEVNTEALPLIDLSSGSPDQPTPPEVIDSLQSAIHRRE 63 Query: 62 NHKYPSYVGKYEFRKAVADWYKRRFDVDLDPNTEVITLIGSKEGIAHFPLAFVNPGDIVL 121 NH YPS+ GK + R+A+A +Y+R++DV+LDP++EV GS GI P A ++PG ++ Sbjct: 64 NHGYPSFWGKPQVREAIAQFYRRQYDVELDPHSEVAVFQGSHIGIGGIPRALLSPGQYLI 123 Query: 122 CPDPAYPVYRIGAIFAGGTPYTVPLKEENNFLPDLDSIPEDVAKKAKIIWINYPNNPTSA 181 DP YP+YR A+ + T Y +PL+ EN+FLPD + +P +VA KA ++ +NYP+NPT A Sbjct: 124 STDPCYPIYRSAALQSQATFYGLPLRAENHFLPDFNDLPREVADKAGLVVLNYPHNPTGA 183 Query: 182 PPTLEFYKKLVDWAKEYNVIIASDNAYSEI-YTGQEKPPSILQVPGAKDVAIEFHSLSKT 240 T + + +A+ + V I D AY+ I + P S+ P AK +E ++ SKT Sbjct: 184 LATPALFASALQFARRHQVPILHDFAYAAIGSAASDAPLSLFSQPNAKAWGVETYTFSKT 243 Query: 241 YNMTGWRIGMAVGNKELVAGLGKVKTNVDSGQFGAVQDAGIVALNLPEEEVEKIRDVYRE 300 +NM GWR G AVGN ++ K+ T+ S FGA+QDA I ALNLP E + ++ VY + Sbjct: 244 FNMAGWRFGFAVGNASIIQAFKKLHTHSYSTVFGAIQDAAIAALNLPAERIAQLTAVYHQ 303 Query: 301 RKKIMTEALEKIGLEIYRSDYTFYLWIKVPEGYTSAEFVGRLIDEAGIVCTPGNGFGEYG 360 R++ + L + + TF+LW+ VP GY S EF L+ EA I+ PG GFGE G Sbjct: 304 RREWVLRRLAALRWPARAAQGTFFLWLGVPPGYRSQEFARLLLQEAHILVAPGTGFGEGG 363 Query: 361 EGYFRISLTVPTERLLEAAERIKNLKL 387 EG+ RISLT + L A +R+ L L Sbjct: 364 EGFIRISLTAGDDALSNALDRLARLAL 390 Lambda K H 0.317 0.139 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 416 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 391 Length adjustment: 30 Effective length of query: 357 Effective length of database: 361 Effective search space: 128877 Effective search space used: 128877 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory