Align Serine O-acetyltransferase; SAT; Homoserine O-acetyltransferase; HAT; Homoserine transacetylase; HTA; EC 2.3.1.30; EC 2.3.1.31 (characterized)
to candidate WP_012969171.1 KVAR_RS24220 homoserine O-succinyltransferase
Query= SwissProt::A0A1D3PCK2 (262 letters) >NCBI__GCF_000025465.1:WP_012969171.1 Length = 309 Score = 141 bits (355), Expect = 2e-38 Identities = 84/255 (32%), Positives = 134/255 (52%), Gaps = 9/255 (3%) Query: 5 VKIGILNLMHDKLDTQSHFIKVLPNADLTFFYPRMHYQNRPI--PPEVNMTSEPLDINRV 62 +K+ ILNLM K++T++ F+++L N+ L + R P ++ + + + + Sbjct: 36 LKVLILNLMPKKIETENQFLRLLSNSPLQVDIQLLRIDARESRNTPTEHLNNFYCNFDEI 95 Query: 63 SE--FDGFIITGAPIDQIDFSKITYIEEIRYLLQALDNHKIQQLYFCWGAMAALNYFYGI 120 + FDG I+TGAP+ ++F+ + Y +I+ +L+ +H L+ CW AALN YGI Sbjct: 96 CDQNFDGLIVTGAPLGLVEFNDVAYWPQIKQVLEWAKDHVTSTLFVCWAVQAALNILYGI 155 Query: 121 KKKILAEKIFGVFPHLITEPHPLLS-GLSQGFMAPHARYAEMDKKQIMQDERLAINAVDD 179 K+ AEKI GV+ H I PH LL+ G F+APH+RYA+ I L I A + Sbjct: 156 PKQTRAEKISGVYEHHILHPHALLTRGFDDSFLAPHSRYADFPAGLIRDYTDLEILAETE 215 Query: 180 NSHLFMVSAKDNPERNFIFSHIEYGKDSLRDEYNREINA--HPERHYKK-PINYSMSNPS 236 ++ ++KD F+ H EY ++L EY R++ A +PE Y P N + P Sbjct: 216 EGDAYLFASKDK-RIAFVTGHPEYDANTLASEYFRDVEAGLNPEVPYNYFPQNDPQNKPR 274 Query: 237 FQWQDTQKIFFNNWL 251 W+ + F NWL Sbjct: 275 ATWRSHGNLLFANWL 289 Lambda K H 0.322 0.138 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 217 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 309 Length adjustment: 26 Effective length of query: 236 Effective length of database: 283 Effective search space: 66788 Effective search space used: 66788 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory