Align Putative [LysW]-L-2-aminoadipate 6-phosphate reductase; EC 1.2.1.103 (uncharacterized)
to candidate WP_012969210.1 KVAR_RS24955 N-acetyl-gamma-glutamyl-phosphate reductase
Query= curated2:B9KZP8 (352 letters) >NCBI__GCF_000025465.1:WP_012969210.1 Length = 334 Score = 184 bits (466), Expect = 4e-51 Identities = 122/351 (34%), Positives = 177/351 (50%), Gaps = 26/351 (7%) Query: 2 VVSVAILGGSGYTGGELLRLLLSHPEVEVKQVTSRSR---AGKFVHTVHPNLRKRTALKF 58 +++ I+G SGY G EL+ + HP + + +T ++ AGK + +HP L+ + Sbjct: 1 MLNTLIVGASGYAGAELVTYINRHPHMNITALTVSAQSNDAGKLISDLHPQLKGIVDMPL 60 Query: 59 VPPEALEP----VDLLFACLPHGETAPIVDRLLELAPIVIDLSADFRLRDPAAYEQWYHW 114 P + VD++F H + + + L +V DLS FR+ D A YE++Y + Sbjct: 61 QPMSDISEFSAGVDVVFLATAHEVSHDLAPQFLAAGCVVFDLSGAFRVNDGAFYEKYYGF 120 Query: 115 THPRPDLLAQAVYGLPELHREEIRNARYIACPGCNSTTVILGLAPLFRAGLIDLDLPVTV 174 TH PDLL QAVYGL E + + ++ A+ IA PGC T L L PL A L+DL+ + Sbjct: 121 THQHPDLLKQAVYGLAEWNADALKEAQLIAVPGCYPTAAQLSLKPLIEANLLDLNQWPVI 180 Query: 175 ECKVGSSGAGGEAGPASHHPERSGVIRPFKPGGHRHTAEVLQEL-TVCGRTPSLGLSVTS 233 G SGAG +A + E S ++P+ HRH E+ L TP LG Sbjct: 181 NATSGVSGAGRKAAIGNSFCEVS--LQPYGIFNHRHQPEIASHLGAKVIFTPHLG----- 233 Query: 234 VEAVRGILATAHLFPKQPLTDRDLWQVYRAAYGQEPFIRLVKEASGIHRYPEPKILAGSN 293 RGIL T K + + VY+ AY +P +RL + P K + G Sbjct: 234 -NFKRGILETITCRLKPGVGHAQIAAVYQQAYADKPLVRLYDKG-----VPALKSVEGLP 287 Query: 294 YCDIGWELDELPGGRQRLVVMSAIDNLMKGAAGQAVQAMNIRLGFPETLGL 344 +CDIG+ + + L+V++A DNL+KGAA QAVQ NIR GF ET L Sbjct: 288 FCDIGFAVQD-----DHLIVVAAEDNLLKGAAAQAVQCANIRFGFAETQSL 333 Lambda K H 0.321 0.140 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 322 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 352 Length of database: 334 Length adjustment: 29 Effective length of query: 323 Effective length of database: 305 Effective search space: 98515 Effective search space used: 98515 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory