Align Homocitrate synthase; EC 2.3.3.14 (characterized)
to candidate WP_012970706.1 ALVIN_RS07410 homocitrate synthase
Query= SwissProt::P05342 (385 letters) >NCBI__GCF_000025485.1:WP_012970706.1 Length = 384 Score = 438 bits (1126), Expect = e-127 Identities = 227/379 (59%), Positives = 284/379 (74%), Gaps = 5/379 (1%) Query: 3 SVIIDDTTLRDGEQSAGVAFNADEKIAIARALAELGVPELEIGIPSMGEEEREVMHAIAG 62 SVII+DTTLRDGEQSAGVAF+ DEK+AIA+ L LGVPELEIGIP+MGEEERE + A+A Sbjct: 7 SVIINDTTLRDGEQSAGVAFSLDEKLAIAQGLDALGVPELEIGIPAMGEEERESIRAVAA 66 Query: 63 LGLSSRLLAWCRLCDVDLAAARSTGVTMVDLSLPVSDLMLHHKLNRDRDWALREVARLVG 122 LGLS+RL+ W R+ D+ R GV +VDLS+P+SD + KL RDR W L ++ R V Sbjct: 67 LGLSARLMVWTRMLADDIVQCRDLGVQLVDLSMPLSDQQIARKLGRDRGWVLAQIERKVR 126 Query: 123 EARMAGLEVCLGCEDASRADLEFVVQVGEVAQAAGARRLRFADTVGVMEPFGMLDRFRFL 182 A GLEVC+G EDASRAD EF+ + E AQAAGARR RFADTVG+M+PFG+ +R L Sbjct: 127 LALDLGLEVCVGGEDASRADSEFLWRAAETAQAAGARRFRFADTVGLMDPFGLYERLHAL 186 Query: 183 SRRLDMELEVHAHDDFGLATANTLAAVMGGATHINTTVNGLGERAGNAALEECVLALKNL 242 R+D+E+E+HAHDD GLATANTLAAV GATH+NTTV+GLGERAGNAALEE V+ L+++ Sbjct: 187 RARVDLEIEMHAHDDLGLATANTLAAVRAGATHVNTTVHGLGERAGNAALEEVVMGLRHV 246 Query: 243 HGIDTGIDTRGIPAISALVERASGRQVAWQKSVVGAGVFTHEAGIHVDGLLKHRRNYEGL 302 G+D G+D + A+S+LV +ASG+ +AW KS+VGAG FTHEAGIHVDGL+K NY+G+ Sbjct: 247 QGLDCGVDLKRFSALSSLVAQASGKPIAWHKSLVGAGAFTHEAGIHVDGLIKDPLNYQGV 306 Query: 303 NPDELGRSHSLVLGKHSGAHMVRNTYRD-LGIELADWQSQALLGRIRAFSTRTKRRSPQP 361 +P ELG +H LVLGKHSG H V+ Y + L EL Q++ LL +R F T TK RSP+ Sbjct: 307 DPAELGLNHRLVLGKHSGRHAVQRVYAESLCFELDQEQAERLLPLVRRFVTETK-RSPET 365 Query: 362 AELQDFYRQLCEQGNPELA 380 +L+ F L E G P+ A Sbjct: 366 GDLRRF---LAEIGYPQTA 381 Lambda K H 0.320 0.135 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 496 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 384 Length adjustment: 30 Effective length of query: 355 Effective length of database: 354 Effective search space: 125670 Effective search space used: 125670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate WP_012970706.1 ALVIN_RS07410 (homocitrate synthase)
to HMM TIGR02660 (nifV: homocitrate synthase (EC 2.3.3.14))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR02660.hmm # target sequence database: /tmp/gapView.16760.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02660 [M=365] Accession: TIGR02660 Description: nifV_homocitr: homocitrate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-163 530.7 1.3 1.2e-163 530.5 1.3 1.0 1 lcl|NCBI__GCF_000025485.1:WP_012970706.1 ALVIN_RS07410 homocitrate syntha Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000025485.1:WP_012970706.1 ALVIN_RS07410 homocitrate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 530.5 1.3 1.2e-163 1.2e-163 2 364 .. 8 371 .. 7 372 .. 0.99 Alignments for each domain: == domain 1 score: 530.5 bits; conditional E-value: 1.2e-163 TIGR02660 2 vlinDttLRDGEqaagvaFsaeEKlaiAkaLdeaGvdelEvGipamgeeEraairaiaalglkarllaW 70 v+inDttLRDGEq+agvaFs +EKlaiA+ Ld++Gv+elE+GipamgeeEr++ira+aalgl+arl++W lcl|NCBI__GCF_000025485.1:WP_012970706.1 8 VIINDTTLRDGEQSAGVAFSLDEKLAIAQGLDALGVPELEIGIPAMGEEERESIRAVAALGLSARLMVW 76 89******************************************************************* PP TIGR02660 71 cRlraedieaaaevGvkavdlsvpvsdlqleaklkkdrawvleelkelvslakeeglkvsvgaeDasRa 139 +R+ a di + +++Gv+ vdls+p sd+q++ kl +dr wvl+++++ v+la + gl+v+vg+eDasRa lcl|NCBI__GCF_000025485.1:WP_012970706.1 77 TRMLADDIVQCRDLGVQLVDLSMPLSDQQIARKLGRDRGWVLAQIERKVRLALDLGLEVCVGGEDASRA 145 ********************************************************************* PP TIGR02660 140 deeflvelaevakeagakRlRfaDtvgvldPfstyelvkalraalelelElHaHnDlGlAtAntlaavk 208 d+efl + ae+a++aga+R+RfaDtvg++dPf+ ye+++alra+++le+E+HaH+DlGlAtAntlaav+ lcl|NCBI__GCF_000025485.1:WP_012970706.1 146 DSEFLWRAAETAQAAGARRFRFADTVGLMDPFGLYERLHALRARVDLEIEMHAHDDLGLATANTLAAVR 214 ********************************************************************* PP TIGR02660 209 aGassvsvtvlGlGERAGnAaleevalalkellgldtgidlselkelsqlvakasgraleaqkavvGes 277 aGa++v++tv GlGERAGnAaleev+++l+++ gld+g+dl+++++ls+lva+asg++++++k++vG+ lcl|NCBI__GCF_000025485.1:WP_012970706.1 215 AGATHVNTTVHGLGERAGNAALEEVVMGLRHVQGLDCGVDLKRFSALSSLVAQASGKPIAWHKSLVGAG 283 ********************************************************************* PP TIGR02660 278 vFaHEsGiHvdgllkdeatYesldPeevGrerelviGKHsgraaviealke.lgleleeeeaeelleav 345 F+HE+GiHvdgl+kd+ +Y+++dP+e+G +++lv+GKHsgr+av+++++e l el++e+ae+ll+ v lcl|NCBI__GCF_000025485.1:WP_012970706.1 284 AFTHEAGIHVDGLIKDPLNYQGVDPAELGLNHRLVLGKHSGRHAVQRVYAEsLCFELDQEQAERLLPLV 352 ***********************************************99752789************** PP TIGR02660 346 ravaerlKrsleeeelaal 364 r++++++Krs+e+ +l+++ lcl|NCBI__GCF_000025485.1:WP_012970706.1 353 RRFVTETKRSPETGDLRRF 371 ***************9876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (365 nodes) Target sequences: 1 (384 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 12.09 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory