Align Homocitrate synthase AksA; EC 2.3.3.14; (R)-homo(2)citrate synthase; EC 2.3.3.-; (R)-homo(3)citrate synthase; EC 2.3.3.- (uncharacterized)
to candidate WP_012972126.1 ALVIN_RS14770 2-isopropylmalate synthase
Query= curated2:Q8TW28 (397 letters) >NCBI__GCF_000025485.1:WP_012972126.1 Length = 534 Score = 187 bits (474), Expect = 8e-52 Identities = 133/381 (34%), Positives = 196/381 (51%), Gaps = 12/381 (3%) Query: 19 VIVYDTTLRDGEQTPGVSFTPEQKLEIAH-LLDELGVQQIEAGFPVVSEGERDAVRRIAH 77 V++ DTTLRDGEQT GVSF P +KL +A LL+++ V +IE VS GE AV +I Sbjct: 23 VLIMDTTLRDGEQTQGVSFAPAEKLNLAKVLLEQVRVDRIEVASARVSSGEASAVAQIID 82 Query: 78 EGLNADILCLARTLRGDVD--AALD--CDVDG-VITFIAT-SELHLKHKLRMSREEVLER 131 ++ L G VD A++D C G V+ +A SE H + +L + +E Sbjct: 83 WARERGLVERVEVL-GFVDGGASVDWICGAGGQVLNLLAKGSEKHCRGQLGKTLDEHAAD 141 Query: 132 IADTVEYAKDHGLWVAFSAED---GTRTEFEFLERVYRTAEECGADRVHATDTVGVMIPA 188 + T+ A+ GL V ED G R +++ + + G DT+GVM P Sbjct: 142 VRATIAAAQSRGLRVNLYLEDWSNGYRDNPDYVYGLVERLADVGIGHFMLPDTLGVMTPD 201 Query: 189 AMRLFVAK-IREVVDLPIGVHCHDDFGMAVANSLAAVEAGAQAISTTVNGIGERAGNAAL 247 + ++ + L H H+D+G+A AN LAAV+AGA A+ TVN +GERAGNA+L Sbjct: 202 QVFTAISDMVGRFPSLQFDFHPHNDYGLATANVLAAVQAGAAAVHCTVNCLGERAGNASL 261 Query: 248 EEVIMALKELYGIDPGFNTEVLAELSRKVSEYSGIDVPPNKAVVGENAFRHESGIHVAAV 307 EV + L++ G + LA +S V +SG + N +VG + F +GIH Sbjct: 262 AEVAVNLRDQLDCALGIDETHLARVSELVESFSGKRISDNAPIVGADVFTQTAGIHADGD 321 Query: 308 LEEPRTYEPIDPKEVGMNRKIVLGKHTGRKAVVAKLEELGVEPEEEIVEEVLKRIKALGD 367 + + + P+ RK LGK G+ ++ LE L +E EE +VL+RI LGD Sbjct: 322 KKGSLYHSRLSPERFARRRKYALGKLAGKASLAKNLERLDIELSEENQRKVLQRIVELGD 381 Query: 368 RRVRVTDSKLEEIVRNVLESR 388 + +T L I+ VLES+ Sbjct: 382 SKKTITTEDLPFIIAEVLESK 402 Lambda K H 0.317 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 428 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 534 Length adjustment: 33 Effective length of query: 364 Effective length of database: 501 Effective search space: 182364 Effective search space used: 182364 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory