Align Putative (R)-citramalate synthase CimA; EC 2.3.3.21 (uncharacterized)
to candidate WP_012973278.1 AZL_RS03450 homocitrate synthase
Query= curated2:Q8TYM1 (509 letters) >NCBI__GCF_000010725.1:WP_012973278.1 Length = 377 Score = 288 bits (736), Expect = 3e-82 Identities = 157/374 (41%), Positives = 219/374 (58%), Gaps = 3/374 (0%) Query: 10 PPDEVRIFDTTLRDGEQTPGVALTPEEKLRIARKLDEIGVDTIEAGFAAASEGELKAIRR 69 P I DTTLRDGEQT GVA T +EK+ IA+ LD GV E G A E E + IR Sbjct: 2 PTTFATINDTTLRDGEQTAGVAFTLDEKIAIAKALDAAGVPEQEIGIPAMGEEEREGIRA 61 Query: 70 IAREELDAEVCSMARMVKGDVDAAVEAEADAVHIVVPTSEVHVKKKLRMDREEVLERARE 129 +A L + RM D+ AA+ + V++ +P S++H+ +KL+ R L Sbjct: 62 VAALGLKGRLMVWCRMHDTDLKAALSCDVGFVNLSMPVSDIHITRKLKRSRAWALAEIER 121 Query: 130 VVEYARDHGLTVEISTEDGTRTELEYLYEVFDACLEAGAERLGYNDTVGVMAPEGMFLAV 189 V+ ARDHGL V + ED +R ++++L AGA R + DT+GV+ P + Sbjct: 122 RVKQARDHGLEVSVGGEDSSRADMDFLIAAASVAQAAGARRFRFADTLGVLDPFQTRACI 181 Query: 190 KKLRERVGEDVILSVHCHDDFGMATANTVAAVRAGARQVHVTVNGIGERAGNAALEEVVV 249 ++LR D+ + +H HDD G+A AN++AAV GA V+ TVNG+GERAGNA LEEVVV Sbjct: 182 ERLRRAT--DLEIEIHAHDDLGLANANSLAAVLGGATHVNTTVNGLGERAGNAPLEEVVV 239 Query: 250 VLEELYGVDTGIRTERLTELSKLVERLTGVRVPPNKAVVGENAFTHESGIHADGILKDES 309 L+ LY +D+G+ T L +S LVER + V NK++VG FTHE+GIH DG+L+D + Sbjct: 240 SLKHLYHIDSGVETRSLGAISDLVERASNRPVAVNKSIVGAAVFTHEAGIHVDGLLRDRA 299 Query: 310 TYEPIPPEKVGHERRFVLGKHVGTSVIRKKLKQMGVDVDDEQLLEILRRLKRLGDRGKR- 368 TY+ P +VG E R VLGKH GT+ ++ + +G+ DD +L R++ L R KR Sbjct: 300 TYQNFDPAEVGREHRIVLGKHSGTAAVKLAYEGLGIACDDSMAQAVLPRVRALATRAKRP 359 Query: 369 ITEADLRAIAEDVL 382 T +L A E L Sbjct: 360 PTPEELHAFLEACL 373 Lambda K H 0.315 0.134 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 488 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 509 Length of database: 377 Length adjustment: 32 Effective length of query: 477 Effective length of database: 345 Effective search space: 164565 Effective search space used: 164565 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory