Align Anthranilate phosphoribosyltransferase; EC 2.4.2.18 (characterized)
to candidate WP_012974214.1 AZL_RS08470 anthranilate phosphoribosyltransferase
Query= SwissProt::P83827 (329 letters) >NCBI__GCF_000010725.1:WP_012974214.1 Length = 344 Score = 249 bits (637), Expect = 5e-71 Identities = 157/331 (47%), Positives = 198/331 (59%), Gaps = 13/331 (3%) Query: 6 KAILGEV-----LEEEEAYEVMRALMAGEVSPVRAAGLLVALSLRGERPHEIAAMARAMR 60 KAILG+V L E EA +M+G +P + G L+AL +RGE EIA AR MR Sbjct: 9 KAILGKVATGAALTEAEAGFAFDIIMSGNATPSQMGGFLMALRVRGETVDEIAGAARVMR 68 Query: 61 EAARPLRVHRRPLLDIVGTGGDGKGLMNLSTLAALVAAAGGVAVAKHGNRAASSRAGSAD 120 A P+ + D GTGGDG G N+ST AALV + GV VAKHGNRA SS++G+AD Sbjct: 69 SKAIPVEAPPGTI-DTCGTGGDGVGTYNISTAAALVVSTCGVPVAKHGNRAISSKSGAAD 127 Query: 121 LLEALGVDLEAPPERVGEAIEELGFGFLFARVFHPAMRHVAPVRAELGVRTVFNLLGPLT 180 +L +LGV+L+ V +A+ + G FL A H AMR+V P R ELG RTVFNLLGPL Sbjct: 128 VLGSLGVNLDCDFALVRKALWDAGIAFLMAPRHHLAMRNVGPTRVELGTRTVFNLLGPLA 187 Query: 181 NPAGADAYVLGVFSPEWLAPMAEALERLGARGL-VVHG-EGADEL-VLGENRVVEVGKG- 236 NPA A VLGVFS +W+AP+A L+RLG+ VVHG +G DE+ G V ++ G Sbjct: 188 NPATAGRQVLGVFSKQWVAPLAHVLKRLGSEAAWVVHGSDGLDEITTTGPTTVAQLKNGE 247 Query: 237 --AYALTPEEVGLKRAPLEALKGGGPEENAALARRLLKGEEKGPLADAVALAAGAGFYAA 294 + + PE+ GL RA +E LKGG + NAA L G + P D V L A A A Sbjct: 248 VTVFEVKPEDAGLPRARIEDLKGGDAQVNAAAIHALFDG-VRSPYRDIVLLNAAAALLVA 306 Query: 295 GKTPSLKEGVALAREVLASGEAYLLLERYVA 325 GK +LKEGVA+A + + SG A L R VA Sbjct: 307 GKAATLKEGVAMAADAIDSGGARDRLRRLVA 337 Lambda K H 0.317 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 318 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 329 Length of database: 344 Length adjustment: 28 Effective length of query: 301 Effective length of database: 316 Effective search space: 95116 Effective search space used: 95116 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_012974214.1 AZL_RS08470 (anthranilate phosphoribosyltransferase)
to HMM TIGR01245 (trpD: anthranilate phosphoribosyltransferase (EC 2.4.2.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01245.hmm # target sequence database: /tmp/gapView.29874.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01245 [M=330] Accession: TIGR01245 Description: trpD: anthranilate phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-123 398.3 0.2 1.6e-123 398.1 0.2 1.0 1 lcl|NCBI__GCF_000010725.1:WP_012974214.1 AZL_RS08470 anthranilate phospho Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000010725.1:WP_012974214.1 AZL_RS08470 anthranilate phosphoribosyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 398.1 0.2 1.6e-123 1.6e-123 2 329 .. 13 337 .. 12 338 .. 0.98 Alignments for each domain: == domain 1 score: 398.1 bits; conditional E-value: 1.6e-123 TIGR01245 2 eklldnkdLseeeaeqlmkeimsgeasdaqiaAilvalrvkgeteeeiaglakalrekakkvekeesee 70 k++++ L+e+ea +++ imsg+a+++q++ +l+alrv+get++eiag+a+++r+ka ve+ lcl|NCBI__GCF_000010725.1:WP_012974214.1 13 GKVATGAALTEAEAGFAFDIIMSGNATPSQMGGFLMALRVRGETVDEIAGAARVMRSKAIPVEA--PPG 79 5788999*******************************************************88..699 PP TIGR01245 71 lvDivGTGGDglktiNiSTasalvaaaaGvkvaKhGnrsvssksGsaDvLealgvnlelspekvarsle 139 +D++GTGGDg+ t+NiSTa+alv++++Gv+vaKhGnr++ssksG+aDvL lgvnl+ + + v+++l lcl|NCBI__GCF_000010725.1:WP_012974214.1 80 TIDTCGTGGDGVGTYNISTAAALVVSTCGVPVAKHGNRAISSKSGAADVLGSLGVNLDCDFALVRKALW 148 ********************************************************************* PP TIGR01245 140 evgigFlfAPkyhpalkevapvRkeLgvrtvfNlLGPLlnParaklqvlGvyskdlvevlaevlknlgv 208 + gi+Fl+AP++h a+++v p+R eLg+rtvfNlLGPL+nPa+a +qvlGv+sk+ v la+vlk+lg+ lcl|NCBI__GCF_000010725.1:WP_012974214.1 149 DAGIAFLMAPRHHLAMRNVGPTRVELGTRTVFNLLGPLANPATAGRQVLGVFSKQWVAPLAHVLKRLGS 217 ********************************************************************* PP TIGR01245 209 kralvvhgedglDEisltgetkvaelkdgeieeytlspedfglkraeleelkggsaeenaellkevleg 277 + a vvhg+dglDEi++tg+t+va+lk+ge++ ++++ped gl+ra++e+lkgg+a+ na+++++++ g lcl|NCBI__GCF_000010725.1:WP_012974214.1 218 EAAWVVHGSDGLDEITTTGPTTVAQLKNGEVTVFEVKPEDAGLPRARIEDLKGGDAQVNAAAIHALFDG 286 ****************************************************************98888 PP TIGR01245 278 kekkakrdivvlNaaaalyvagkakdlkegvelakeaiksgkalekleelva 329 ++ rdiv+lNaaaal+vagka++lkegv +a +ai+sg a + l++lva lcl|NCBI__GCF_000010725.1:WP_012974214.1 287 VR-SPYRDIVLLNAAAALLVAGKAATLKEGVAMAADAIDSGGARDRLRRLVA 337 77.899*****************************************99986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (330 nodes) Target sequences: 1 (344 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.18 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory