Align Glutamyl-tRNA(Gln) amidotransferase subunit A; Glu-ADT subunit A; EC 6.3.5.7 (uncharacterized)
to candidate WP_012976316.1 AZL_RS20165 allophanate hydrolase
Query= curated2:C1F857 (476 letters) >NCBI__GCF_000010725.1:WP_012976316.1 Length = 608 Score = 204 bits (520), Expect = 5e-57 Identities = 154/423 (36%), Positives = 210/423 (49%), Gaps = 34/423 (8%) Query: 51 ARARHIDALSREERAKLPMGGVPFGIKDVLTVEGMPATASSKILEGYRPPYTATAVQRLI 110 ARA ++AL+ ERA LP+ GVPF +KD + V G+P TA+ Y TATAVQRL+ Sbjct: 64 ARAAALEALTPAERAALPLYGVPFAVKDNIDVAGLPTTAACPEYT-YTATDTATAVQRLL 122 Query: 111 DAGAVLVGKLNCDEFAMGSSNENSAYGPVKNPRALDRVPGGSSGGSAAAVAANMAVATLG 170 DAGA+LVGK N D+FA G S YG +NP VPGGSS GSA AVA+ + LG Sbjct: 123 DAGAILVGKANLDQFATGLVGVRSPYGVARNPIDPLCVPGGSSSGSAVAVASGLVGFALG 182 Query: 171 TDTGGSIRQPASFCGVVGVLPTYGRVSRYGLIAFASSLDRVGPFAHTVRDAAEVLGVIAG 230 TDT GS R PA+F +VG+ PT G VS G++ SLD V FA TV DA +VL V+A Sbjct: 183 TDTAGSGRVPAAFTNIVGLKPTKGLVSTAGVVPACRSLDCVSVFALTVEDAMDVLAVMAA 242 Query: 231 HDPMDATSSSVPVPDYTEKLDAGVKG-LRLGVP-AEYFAEGLDPEVKRAVEGTIEQLRAA 288 DP+DA S + P + A ++ R GVP A+ + E +R +++L Sbjct: 243 PDPLDAYSRAAP------PVPAALRAPFRFGVPQADQLRFFGNVEAERLYREALDRLTGL 296 Query: 289 GAEVKPISLPHTPYAIPTYYVIATAEASANLARFDGVRYGLRAPEANTLAAMYRQTRDLG 348 G P+ P+ AE +A L + G R A Y Sbjct: 297 GGVAVPVDF--APF----------AETAALL--YSGPWVAERTAAVGEFLADYTDA---- 338 Query: 349 FGAEVKRRILLGTYVLSAGYYDAYYKKAQQVRRLLAQDFLRAFEEVDAIVTPTAPTPAFK 408 G V R I+ G + A D + +A L +D ++ +D + PT T + Sbjct: 339 -GLAVTRGIIEGGHKHDA--VDCF--RAMYRLEALRRDTAAVWDAIDLLAVPTTGT-IYT 392 Query: 409 LGEKSDDPLSMYL-ADIYTVTANLAGICGASVPCGTSREGLPIGIQILGRHFDEATVLRV 467 + E DP+++ YT NL +CG ++P G +G P G+ +L F EA V V Sbjct: 393 VAEVMADPVALNTNLGTYTNFTNLLDLCGIAIPSGFQADGRPAGLTLLAPAFREAAVATV 452 Query: 468 GQA 470 A Sbjct: 453 AAA 455 Lambda K H 0.317 0.134 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 762 Number of extensions: 40 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 476 Length of database: 608 Length adjustment: 35 Effective length of query: 441 Effective length of database: 573 Effective search space: 252693 Effective search space used: 252693 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory