Align Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 (uncharacterized)
to candidate WP_012976453.1 AZL_RS20900 aspartate aminotransferase family protein
Query= curated2:Q8TUZ5 (389 letters) >NCBI__GCF_000010725.1:WP_012976453.1 Length = 462 Score = 184 bits (466), Expect = 6e-51 Identities = 139/403 (34%), Positives = 198/403 (49%), Gaps = 42/403 (10%) Query: 26 EGARVWDDEGNEYIDLVAGIAVNVLGHCHPAVVEAVKEQVERLIHCSNLYYNEPQAEAAR 85 EG + D +G ++D G +V+ +G+ HP +V A+K Q++ L + EP AE A Sbjct: 55 EGIWIEDMDGRRFMDF-HGNSVHHIGYSHPRLVAALKAQMDDLTFAPRRFACEPAAELAE 113 Query: 86 LLAEAAPKDLN-KVFFCNSGTESVECAIKLARKFTGCTKFIAFEGGFHGRTMGALSATWK 144 LA AP +V F G+E +E A+KLAR TG K ++F FHG GA + Sbjct: 114 RLAALAPTGPGGRVLFAPGGSEGIEIALKLARVATGRFKTVSFWDAFHGAGFGASGVGGE 173 Query: 145 PEFREP-FEPLVPEFEHV--------PYG---------DVNAVEKAI----------DDD 176 FR PL+P EHV PYG D++A + D Sbjct: 174 ALFRSHGIGPLLPGTEHVAPFACARCPYGFDPAPGGGPDLDACRMTCARMLRYVLEKEGD 233 Query: 177 TAAVIVEPVQGEAGVRIPPEGFLRELRELCDEHGLLLIVDEVQSGMGRTGQFFAFEHEDV 236 AAV+ EPV+ A +PP GF E+R CD G LLI DE+ +G+G+TG F+ E Sbjct: 234 VAAVVAEPVR--AVPYVPPPGFWAEVRRACDAAGALLIFDEIPTGLGKTGSLFSHEPFGA 291 Query: 237 LPDIVCLAKGLGGG-VPVGATIAREEVAEAFEPGDHGSTFGGNPLACAAVCAAVSTVLEE 295 PDI+ L K LGG +P+ A IAR + A + T NPL A + + +E Sbjct: 292 RPDILVLGKALGGAMLPLAAVIARAGLDVAADRALGHYTHEKNPLLARAGLTTLDIIRDE 351 Query: 296 NLPEAAERKGKLA---MRILSEAEDVVEEVRGRGLMMGVEVGDD------ERAKDVAREM 346 L E A G A +R L+ A + +RG GL++GVE+ D +RA+ Sbjct: 352 GLAERAAGLGAHALDRLRELTAALPGIAGIRGAGLLIGVELADHDGVSGADRAEAAFYAA 411 Query: 347 LDRGALVNVTSGDVIRLVPPLVIGEDELEKALAELADALRASG 389 L G + ++ V+ L PPL I EL++ALA +A A+ A+G Sbjct: 412 LVGGVSLKISQATVLTLSPPLTIARTELDQALAVVARAISAAG 454 Lambda K H 0.318 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 440 Number of extensions: 28 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 389 Length of database: 462 Length adjustment: 32 Effective length of query: 357 Effective length of database: 430 Effective search space: 153510 Effective search space used: 153510 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory