Align aromatic-amino-acid transaminase [EC:2.6.1.57] (characterized)
to candidate WP_012977338.1 AZL_RS25665 aspartate/tyrosine/aromatic aminotransferase
Query= reanno::Phaeo:GFF2895 (394 letters) >NCBI__GCF_000010725.1:WP_012977338.1 Length = 390 Score = 338 bits (866), Expect = 2e-97 Identities = 178/382 (46%), Positives = 241/382 (63%), Gaps = 3/382 (0%) Query: 1 MFETLKPQPADKILALMQMYRDDPRDSKIDLGVGVYKNAEGVTPVMRAIKAAEHKLWEEQ 60 MF L QP D +LAL+ +Y+ D R +K+DLGVGVY++ EG TPV RA+KAAE L + Q Sbjct: 1 MFNALSRQPDDALLALIGLYKQDTRPNKVDLGVGVYRDEEGRTPVFRAVKAAERSLLDGQ 60 Query: 61 TSKSYVGLAGDPAYSDAMIKLILSDSVARANVAAAATPGGTGAVRQAFELIKMANPGARV 120 SK+Y+GL GD Y + + L+ + A+ A TPGG+GA+R A +L+ + RV Sbjct: 61 DSKAYLGLEGDALYLERLWSLVGGAAGAKVTAAGVQTPGGSGALRLAADLL-LRGGSKRV 119 Query: 121 FVSNPTWPNHISILNYLNIETVAYRYFDRETCGVDFDGMIADLKTANKGDVVLLHGCCHN 180 V PTWPNH+ I +E V++ +FD + V FD MIA + A +GDV LLH CHN Sbjct: 120 LVGQPTWPNHVGIFAAAGLEVVSHPFFDTASQAVLFDRMIAAFEAARQGDVALLHASCHN 179 Query: 181 PTGANLNMVQWQEVVAILNERGLIPMIDIAYQGFGDGLEEDAQGVRYVAANTPECLIAAS 240 PTGA L++ QW+ + +L ERG++P++D+AYQGFG GL+EDA+G+R++ PE L+A S Sbjct: 180 PTGAPLSLDQWKTLSTVLEERGVLPLVDLAYQGFGRGLDEDAEGLRHLIGAVPETLVAVS 239 Query: 241 CSKNFGIYRERTGLLMAVSQDSGAQALNQGTLAFLNRQNYSFPPDHGARLVSMILNDDAL 300 SK+FG+YRERTG + AV+ A L + L L R +YS PPDHGA +V IL D AL Sbjct: 240 SSKSFGLYRERTGAIFAVAAVPAAADLAKSNLMGLARTSYSMPPDHGAAVVRTILGDAAL 299 Query: 301 RADWAAELEETRLGMLALRQQLADELQRLTGSDRFGFLAQHRGMFSLLGTTPEMVEKMRA 360 ADW AEL+ R + +R++LA L +A GMFSLL T V ++RA Sbjct: 300 TADWTAELDGMRARITGIRRKLAAGL--AGAFPALTAVAAQEGMFSLLPLTEAEVLRLRA 357 Query: 361 ESGIYMVGDSRMNIAGLNTQTV 382 + IYM R+NIAGL T V Sbjct: 358 DHAIYMPTSGRINIAGLKTAEV 379 Lambda K H 0.319 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 386 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 394 Length of database: 390 Length adjustment: 31 Effective length of query: 363 Effective length of database: 359 Effective search space: 130317 Effective search space used: 130317 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory