Annotation: NCBI__GCF_000010725.1:WP_012977440.1
Length: 374 amino acids
Source: GCF_000010725.1 in NCBI
| Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
|---|---|---|---|---|---|---|---|---|---|
| L-arginine biosynthesis | argE | hi | acetylornithine deacetylase (EC 3.5.1.16) (characterized) | 68% | 99% | 522.3 | nucleoside deoxyribosyltransferase (EC 2.4.2.6) | 31% | 68.6 |
| L-arginine biosynthesis | argE | hi | argE: acetylornithine deacetylase (ArgE) (EC 3.5.1.16) (TIGR01892) | 100% | 458.9 | nucleoside deoxyribosyltransferase (EC 2.4.2.6) | 31% | 68.6 | |
| L-proline biosynthesis | argE | hi | acetylornithine deacetylase (EC 3.5.1.16) (characterized) | 68% | 99% | 522.3 | nucleoside deoxyribosyltransferase (EC 2.4.2.6) | 31% | 68.6 |
| L-proline biosynthesis | argE | hi | argE: acetylornithine deacetylase (ArgE) (EC 3.5.1.16) (TIGR01892) | 100% | 458.9 | nucleoside deoxyribosyltransferase (EC 2.4.2.6) | 31% | 68.6 | |
| L-lysine biosynthesis | dapE | lo | Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; EC 3.5.1.18; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase (uncharacterized) | 30% | 93% | 110.9 | acetylornithine deacetylase (EC 3.5.1.16) | 68% | 522.3 |
View WP_012977440.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
MTVIDILKDLIAVPSVVGTPNTAIVDAIRGVLEAAGVRVRVLPGPEGDRFNLFATIGPAM VPGYVLSGHMDVVPATEPEWTSDPFHLRADGDRLFGRGTSDMKGFIAAVLAALPALTSAP LARPIHLAFTYDEEAGCQGAPHLMPHLPSLCAPPLGVIVGEPSGLRAIRAHKGKAAARLT IRGRSGHSSRPDQGLNAIHAMADALTAAVTQAGRLTQGPLDAVFEPPYSSLQVGTIDGGR AVNIIPDACTAEFEARAIAGIDPVTLLEPVRLAAERLEERGFAVDWAQTGAYPALSLPAR SPLARLLEELTGQEPLAAVSYGTEAGLYQTAGIDAIICGPGDIARAHRPDEHILVGELRA CQSMIEALGERCRL
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory