Align Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; EC 3.5.1.18; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase (uncharacterized)
to candidate WP_012978324.1 AZL_RS31045 acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase family protein
Query= curated2:B2FIC0 (375 letters) >NCBI__GCF_000010725.1:WP_012978324.1 Length = 435 Score = 121 bits (304), Expect = 3e-32 Identities = 117/393 (29%), Positives = 170/393 (43%), Gaps = 47/393 (11%) Query: 7 LTCELIARPSVTPDD---AGCQALLAARLKQAGFQCDHLRL----GDVDNLWATHGLG-- 57 LT LI P+V P C L+ RL GF +++R GD D T+ + Sbjct: 27 LTQALIRIPTVNPPGDAYTDCALLIGRRLAARGFTVEYVRAEGAAGDSDRYPRTNIVARI 86 Query: 58 -----APVLVLLGHTDVVPTGPRESWTSDPFTPHIRDGVLYGRGAADMKGSVAAFVVAAE 112 P + GH DVVP G + WT DPF ++DG +YGRGA DMKG +AA +VA E Sbjct: 87 EGPRPGPCVHFNGHIDVVPAG--QGWTVDPFAGVVKDGRVYGRGACDMKGGIAASIVAVE 144 Query: 113 QFVADHPDHPGTLAVLLTSDEEGDAIDGVRHVARLFAARGQRIDWCITGEPSSTATLGDL 172 + + G L + T DEE GV H+A L R+D I EP + D Sbjct: 145 SLLEEGLLTAGALEISGTVDEESGGYGGVGHLATLGYFSRPRVDHVIIPEPLNV----DR 200 Query: 173 LRVGRRGSLSAKLRVQGVQGHVAYPEKARNPI-HQAA-------PALAELCARRWDDGY- 223 + +G RG A++ +G H + P + H A L L +R Sbjct: 201 VCIGHRGVWWAEIETRGRVAHGSMPFLGNCAVRHMGAVLHRIETELLPRLAVKRTAMPVV 260 Query: 224 -ESFPPTSLQISNIHAGTGANN------VIPGELDVDFNIRYNPHWDAPKLEAEITALLE 276 E +++ I+ IH G ++ ++P + + RY D + EI A+LE Sbjct: 261 PEGARQSTININAIHGGQREDHDGLPSPMVPDRCRMVIDRRYLIEEDPEAVRGEIVAILE 320 Query: 277 -----RHGLQYTLKWHRSGEPFYTPEG--TLRAIARAVLAEHIGRAPEESTGGGTSDARF 329 R G Y L+ + P T +RA+A A + +GR + GT D + Sbjct: 321 DLRRNRPGFDYELREVLAFLPTMTDADAPVVRAVA-AAIETVLGRPARQVVSPGTYDQKH 379 Query: 330 IAPLG--AQCIEVGP-VNASIHQVDENVRVDDL 359 + +G CI GP + HQ DE V +DD+ Sbjct: 380 VVRIGNLKDCIAYGPGILDLAHQPDEWVGIDDM 412 Lambda K H 0.319 0.137 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 480 Number of extensions: 26 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 435 Length adjustment: 31 Effective length of query: 344 Effective length of database: 404 Effective search space: 138976 Effective search space used: 138976 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory