Align Histidinol-phosphate aminotransferase; EC 2.6.1.9; Imidazole acetol-phosphate transaminase (uncharacterized)
to candidate WP_012991079.1 THAL_RS00165 pyridoxal phosphate-dependent aminotransferase
Query= curated2:Q46E46 (366 letters) >NCBI__GCF_000025605.1:WP_012991079.1 Length = 393 Score = 91.7 bits (226), Expect = 3e-23 Identities = 86/264 (32%), Positives = 126/264 (47%), Gaps = 31/264 (11%) Query: 70 PSADAIELREALS-------RYTGFPVSNLIASGPGMDGLLDGLCRLVIEKGDEVIVPTP 122 PSA + LREALS R P ++ +G M L L V+ +GDEV++P+P Sbjct: 64 PSAGILPLREALSEKLKKENRVEYSPSQIVVTAGAKMALYLVFLA--VLNEGDEVLLPSP 121 Query: 123 TFAYYELPARACGGKPVFVRRSQD--FSIDPEKLLEATSSRTKIIFLCSPNNPSGNLLPE 180 + Y + CGGKPV V S+D F + E LL + RT+++ L SP+NP+G ++P Sbjct: 122 YWVSYPEQIQLCGGKPVVVPLSEDKGFVLTAEDLLPYITERTRMLVLNSPSNPTGAVVPP 181 Query: 181 KDLRKVLE---NTRALVFVDEAYVEFADR----NLAELVREY-DNLVVGRTFSKVFGLAG 232 K+L ++ + R + DE Y F ++A L E D FSK F + G Sbjct: 182 KELERIAQLCVERRIFIVSDECYEAFVYEGEFVSVASLSPEVRDITFTVNAFSKTFSMTG 241 Query: 233 LRLGYGIMPEWLAK-------EYIRAATPFSV--SLPALKAGIAALSDVEHRKKSIEIAR 283 R+GY PE A+ + + AT F+ +L AL A S VE K++ R Sbjct: 242 WRVGYVASPEPFARVIADLNSQTLSNATSFAQYGALEAL-TNPQARSFVEKMKETFRERR 300 Query: 284 EGRKYLKEKIPF--KVYPSQANFV 305 L +IP V PS A ++ Sbjct: 301 NTALRLLSQIPHVKVVKPSGAFYI 324 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 359 Number of extensions: 25 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 366 Length of database: 393 Length adjustment: 30 Effective length of query: 336 Effective length of database: 363 Effective search space: 121968 Effective search space used: 121968 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory