Align Histidinol-phosphate aminotransferase; EC 2.6.1.9; Imidazole acetol-phosphate transaminase (uncharacterized)
to candidate WP_012991370.1 THAL_RS01625 histidinol-phosphate transaminase
Query= curated2:O67857 (354 letters) >NCBI__GCF_000025605.1:WP_012991370.1 Length = 351 Score = 406 bits (1043), Expect = e-118 Identities = 199/350 (56%), Positives = 263/350 (75%) Query: 1 MIPQRIKELEAYKTEVTPASVRLSSNEFPYDFPEEIKQRALEELKKVPLNKYPDPEAKEL 60 MI RIK L YKTE A V+LSSNE D P E+K+ + ++P N+YPDP+A EL Sbjct: 1 MISARIKGLSPYKTEKRSAKVKLSSNELSLDLPAEVKEEIARAVARIPFNRYPDPQATEL 60 Query: 61 KAVLADFFGVKEENLVLGNGSDELIYYLSIAIGELYIPVYIPVPTFPMYEISAKVLGRPL 120 K +A FGV +VLGNGSDELI YL +A+GE V+ PVPTFPMY ISA+ +G+ Sbjct: 61 KEAVALRFGVDPSCVVLGNGSDELIQYLCMAVGESGDAVFYPVPTFPMYGISAQTVGKER 120 Query: 121 VKVQLDENFDIDLERSIELIEKEKPVLGYFAYPNNPTGNLFSRGKIEEIRNRGVFCVIDE 180 ++V L E+ DIDL+ S++ I + KP+L +F+YPNNPTGN F + KI IRN GVFCVIDE Sbjct: 121 LEVPLGEDLDIDLDSSLKEIRRRKPILAFFSYPNNPTGNCFDKNKITAIRNEGVFCVIDE 180 Query: 181 AYYHYSGETFLEDALKREDTVVLRTLSKIGMASLRVGILIGKGEIVSEINKVRLPFNVTY 240 AYYH+SG+TFLE+AL REDTVVLRTLSKIGMA LRVG+LI + ++ IN++RLPFN+TY Sbjct: 181 AYYHFSGKTFLEEALSREDTVVLRTLSKIGMAGLRVGVLIARQDVADYINRMRLPFNITY 240 Query: 241 PSQVMAKVLLTEGREFLMEKIQEVVKERERMYDEMKKIEGVEVFPSKANFLLFRTPYPAH 300 PSQV+A ++LT+ F+ E + V +ER+R+ D ++ ++GVEVFPS+ANF LFRTP PA Sbjct: 241 PSQVIAVLMLTKFYHFVEEAVNTVKRERDRLMDALRSMKGVEVFPSEANFFLFRTPLPAP 300 Query: 301 EVYQELLKRDVLVRNVSYMEGLQKCLRVSVGKPEENNKFLEALEESIKSL 350 + ++LL+ VLVR+VSY+ L++CLRVS+GKPEEN+ FLEAL + I+ + Sbjct: 301 LLQEKLLEEGVLVRDVSYLPRLERCLRVSIGKPEENDAFLEALHKVIEKM 350 Lambda K H 0.317 0.138 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 416 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 354 Length of database: 351 Length adjustment: 29 Effective length of query: 325 Effective length of database: 322 Effective search space: 104650 Effective search space used: 104650 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_012991370.1 THAL_RS01625 (histidinol-phosphate transaminase)
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.5394.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-106 341.8 0.0 2.1e-106 341.7 0.0 1.0 1 lcl|NCBI__GCF_000025605.1:WP_012991370.1 THAL_RS01625 histidinol-phosphat Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000025605.1:WP_012991370.1 THAL_RS01625 histidinol-phosphate transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 341.7 0.0 2.1e-106 2.1e-106 3 348 .. 5 345 .. 3 346 .. 0.96 Alignments for each domain: == domain 1 score: 341.7 bits; conditional E-value: 2.1e-106 TIGR01141 3 kikklepYqpgarelgekevvkLnsnEnPfgpsekvkealkeelk..klhrYpdpqalelkealakylg 69 +ik l+pY++ + +++ vkL+snE ++ + +vke++ ++++ +++rYpdpqa+elkea+a ++g lcl|NCBI__GCF_000025605.1:WP_012991370.1 5 RIKGLSPYKT-E---KRSAKVKLSSNELSLDLPAEVKEEIARAVAriPFNRYPDPQATELKEAVALRFG 69 7999******.3...334679***********************99999******************** PP TIGR01141 70 veeenillgnGsdelielliraflepgdavlvleptysmYevsakiagaevkevplked.gqedleavl 137 v++ ++lgnGsdeli++l++a+ e+gdav ++ pt+ mY +sa++ g e evpl ed + +++ lcl|NCBI__GCF_000025605.1:WP_012991370.1 70 VDPSCVVLGNGSDELIQYLCMAVGESGDAVFYPVPTFPMYGISAQTVGKERLEVPLGEDlDIDLDSSLK 138 ***********************************************************7777777888 PP TIGR01141 138 eaakekvklvflasPnnPtGnllkreeiekvleevedalVVvDeAYieFseeasvlellaeypnlvvlr 206 e++ +k+ l f+ +PnnPtGn++++++i+++ +e +++V+DeAY++Fs++ ++le + +++ vvlr lcl|NCBI__GCF_000025605.1:WP_012991370.1 139 EIRRRKPILAFFSYPNNPTGNCFDKNKITAIRNE--GVFCVIDEAYYHFSGK-TFLEEALSREDTVVLR 204 8********************************9..5**************7.**************** PP TIGR01141 207 TlSKafgLAglRvGyaianaeiiealekvrapynvsslaleaavaalrdsd.kiektveevkkererll 274 TlSK+ +AglRvG++ia ++++++++++r p+n++++++ +av l++ ++e+ v+ vk+er+rl+ lcl|NCBI__GCF_000025605.1:WP_012991370.1 205 TLSKIG-MAGLRVGVLIARQDVADYINRMRLPFNITYPSQVIAVLMLTKFYhFVEEAVNTVKRERDRLM 272 ****97.*****************************************98889**************** PP TIGR01141 275 eelkkleglevyeSkaNFvlikvkedaeelleallekgiivRdlksaeglleeclRitvGtreenerll 343 ++l+ ++g+ev++S+aNF l++++ +a l e+lle+g++vRd++ + le clR+++G++een+++l lcl|NCBI__GCF_000025605.1:WP_012991370.1 273 DALRSMKGVEVFPSEANFFLFRTPLPAPLLQEKLLEEGVLVRDVSYLP-RLERCLRVSIGKPEENDAFL 340 ********************************************9886.57****************** PP TIGR01141 344 ealke 348 eal++ lcl|NCBI__GCF_000025605.1:WP_012991370.1 341 EALHK 345 **987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (351 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.45 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory