Align succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate WP_012991510.1 THAL_RS02335 glutamate-1-semialdehyde-2,1-aminomutase
Query= BRENDA::A0A140N9B6 (406 letters) >NCBI__GCF_000025605.1:WP_012991510.1 Length = 424 Score = 126 bits (316), Expect = 1e-33 Identities = 101/334 (30%), Positives = 156/334 (46%), Gaps = 33/334 (9%) Query: 22 PFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGYTNE 81 P + +G RLWD +GKEYIDF LGHAHP + + Q S+ G T Sbjct: 32 PIVVREAKGCRLWDVEGKEYIDFLMSWGPLILGHAHPYVVSEVERQLSR--GMSYGLTCY 89 Query: 82 PVLRLAKKLIDAT-FADRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGIVAFKNAFHG 140 +RLA+ ++ + + V F +SG EA +A++LAR + ++ +V F+ +HG Sbjct: 90 EEIRLAELVVSSVPSVEMVRFVSSGTEATMSAIRLARGYTGRKF------VVKFEGCYHG 143 Query: 141 R-TLFTVSAG---------GQPAYSQDFAPLPADIRHAAYNDINSASALID---DSTCAV 187 VSAG G P ++ A L + YND ++ + + + V Sbjct: 144 HYDGLLVSAGSGVATLGIPGTPGVPEEIAGLTLVL---PYNDTDAVLSTFERYGEDIACV 200 Query: 188 IVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDL 247 IVEP+ G GVV S FL+ LRE+ ++ A+LIFDEV T R A +Y + PD+ Sbjct: 201 IVEPVAGNMGVVLPSEGFLEVLREVTRKYGAVLIFDEVITNF-RLSVGGAQEYYAIDPDI 259 Query: 248 LTTAKALGGGFPVGALLATEECARVMTVGTHGTTY-----GGNPLASAVAGKVLELINTP 302 K LGGG P+GA +E + V G Y GNP++ LE + Sbjct: 260 TCMGKILGGGMPLGAYGGKKEI--MSHVAPEGKVYQAGTLSGNPVSVVCGRATLEELLRL 317 Query: 303 EMLNGVKQRHDWFVERLNTINHRYGLFSEVRGLG 336 + +++R E ++T+ G+ + +G Sbjct: 318 KPYQLLEERTRRLAEGISTVLKEKGIPHTINRIG 351 Lambda K H 0.319 0.135 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 416 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 424 Length adjustment: 31 Effective length of query: 375 Effective length of database: 393 Effective search space: 147375 Effective search space used: 147375 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory