Align Fructose-bisphosphate aldolase class 1; Fructose-bisphosphate aldolase class I; FBP aldolase; FBPA; EC 4.1.2.13 (characterized)
to candidate WP_012991580.1 THAL_RS02685 fructose-bisphosphate aldolase
Query= SwissProt::P58315 (263 letters) >NCBI__GCF_000025605.1:WP_012991580.1 Length = 266 Score = 163 bits (413), Expect = 3e-45 Identities = 95/251 (37%), Positives = 149/251 (59%), Gaps = 10/251 (3%) Query: 16 GKSIILAYDHGIEHGPADFMDNPDSADPEYILRLARDAGFDGVVFQRGIAEKYYDG---S 72 GK+II+ DHG+ GP + + + SA + + G D VV +G+ + G Sbjct: 18 GKTIIVPMDHGVSSGPIEGIVDIRSAVAD-----VAEGGADAVVLHKGMVRAGHRGRGRD 72 Query: 73 VPLILKLNGKTTLYNGEPVSVANCSVEEAVSLGASAVGYTIYPGSGFEWKMFEELARIKR 132 + LI+ L+ T + V C+VEEA+ LGA V + G+ E +M +L + + Sbjct: 73 IGLIVHLSASTDWAPTKNDKVLVCTVEEAIKLGADGVSVHVNIGADLEREMLRDLGYVAK 132 Query: 133 DAVKFDLPLVVWSYPRGGKVVNETAPEIVAYAARIALELGADAMKIKYTGDPKTFSWAVK 192 ++ +PL+ Y RG K +N+ P++VA+ AR+ ELGAD +K+ YTGDP+TF AV+ Sbjct: 133 VCEEWGMPLLAMVYGRG-KDMNQYDPQVVAHCARLGAELGADIVKVPYTGDPETFCKAVE 191 Query: 193 VAGKVPVLMSGGPKTKTEEDFLKQVEGVLEAGALGIAVGRNVWQRRDALKFARALAELVY 252 VPV+++GGPK KTEE+ L+ V G L+AGA G+++GRNV+Q +D ++ RAL LV+ Sbjct: 192 GC-PVPVVIAGGPKMKTEEEVLRMVYGALQAGAKGLSIGRNVFQAKDRVRMVRALYHLVH 250 Query: 253 GGKKLAEPLNV 263 G + E L++ Sbjct: 251 KGGTVDEALSI 261 Lambda K H 0.318 0.138 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 206 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 266 Length adjustment: 25 Effective length of query: 238 Effective length of database: 241 Effective search space: 57358 Effective search space used: 57358 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory